Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6228
Gene name
LocationContig_668:3637..6115
Strand+
Gene length (bp)2478
Transcript length (bp)1932
Coding sequence length (bp)1932
Protein length (aa) 644

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase 1.7E-13 347 625

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q99289|HLT_VIBPA Thermolabile hemolysin OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=VPA0226 PE=1 SV=2 347 634 4.0E-07

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 49 71 22
3 105 127 22
4 160 182 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6228
MPTCPVQGNADLYGLGIRIGLYIQMITVQLSGVLSASFRVEDHIGQGTIIFVASTVIILVRLINASISSATSADD
DAALDAVEVFPVLTLLLVQTGVCRVSSRNRLAMLVWVAELVGLAALYNYFWWRGMDMLPRSCPDDKAFFFARVSI
WGWYRSLNKALGVFAAIGVAFTVVSFCGSVIYELVRCVLYLVARQADNSSTSGSSVGANDGSRVKQKPSPAIGSI
DLLANVGAIVYVEVSLRWNSITGVHSLDSPGQFMPLVIALGQFLSVFYSAAKQLLVMNANEDLAGEEEDDAAECH
HAMFHAEQYPVAANRSGDRWQARLPDVSRTTTLCLALLLQLSRGFNLVTFGDSYTDEGRLRYMLKHGREPPPGLI
LSPSSQTASGGFNWPRVVAQRTGASSYNFAVSGAMCSNDLVPDRKLDATGAPFPSVSGYEMDAFEAAAAMGRIGR
PQETVYALWIGTNDLGERGLLSGRQRPNATVEDVVDCMWGVINRLYDAGGRRFVIFNMIPLEKAPLYGGPGSKAA
ENRNKLRKYTSSVNALLGEDAPQLLRWRWSGATLSLLDVHSIVTDVIAKPSCYLDAPANSAIPFHNCEPPCFDSP
GKLSSYLWYDSLHPSARIEEVFGQEFIKLLQQGNTKFGKTFQG*
Coding >Ophun1|6228
ATGCCCACTTGTCCCGTCCAAGGAAACGCCGACCTCTACGGCCTCGGCATCCGCATCGGCCTGTACATCCAGATG
ATAACAGTCCAGCTCTCGGGCGTCCTCAGCGCCAGCTTCCGGGTAGAGGACCACATCGGACAAGGCACCATCATC
TTCGTCGCCTCAACCGTCATCATTCTAGTACGGCTCATCAACGCCAGCATCAGCAGCGCGACATCCGCAGACGAT
GACGCCGCTCTCGACGCCGTCGAAGTCTTCCCCGTTTTGACCCTCTTGCTCGTTCAGACGGGTGTGTGCCGCGTC
TCGTCACGCAACAGGCTGGCCATGCTCGTTTGGGTTGCTGAGCTCGTTGGCTTGGCTGCGCTGTACAACTATTTC
TGGTGGCGCGGCATGGACATGCTGCCGCGGTCGTGTCCGGACGACAAGGCCTTCTTCTTTGCTCGTGTCAGCATC
TGGGGCTGGTATCGAAGCCTCAACAAGGCGCTGGGAGTCTTTGCTGCCATTGGCGTTGCCTTTACGGTCGTCTCA
TTCTGCGGATCCGTCATCTACGAGCTCGTCCGCTGTGTCCTCTACCTCGTGGCGAGACAGGCCGACAATAGCAGC
ACCAGCGGCAGCAGCGTCGGCGCAAATGACGGATCCAGGGTCAAGCAAAAGCCCAGTCCGGCCATCGGGTCCATC
GATCTGCTGGCCAACGTCGGCGCAATCGTCTACGTCGAGGTCTCTTTGCGCTGGAACAGCATCACGGGCGTGCAC
TCCCTCGACAGCCCCGGCCAGTTCATGCCCCTGGTCATCGCCCTGGGCCAGTTCCTATCCGTCTTCTATTCGGCC
GCTAAGCAGCTGCTGGTGATGAACGCCAACGAGGACCTCGCCGGAGAGGAAGAGGATGATGCAGCCGAGTGTCAC
CACGCCATGTTCCATGCCGAACAGTACCCAGTGGCGGCCAACCGCAGCGGCGACCGCTGGCAAGCCCGTCTGCCC
GATGTCTCACGAACGACGACACTTTGCCTGGCTCTGCTGCTGCAGCTGAGCCGGGGCTTCAACCTCGTAACCTTT
GGCGACAGCTACACTGACGAGGGCCGGCTCCGATACATGCTCAAACATGGACGGGAGCCTCCGCCCGGCCTGATC
CTCTCTCCGTCCAGCCAGACCGCTAGCGGCGGCTTCAACTGGCCTCGCGTCGTTGCGCAGCGCACGGGGGCGAGC
TCCTACAACTTTGCCGTCTCCGGCGCCATGTGCTCCAATGATCTCGTGCCGGACCGCAAGCTGGACGCCACGGGG
GCGCCGTTCCCGTCTGTCTCCGGCTATGAGATGGATGCCTTCGAGGCTGCCGCTGCCATGGGCCGGATCGGGAGG
CCGCAGGAGACCGTTTATGCTCTTTGGATCGGCACCAACGACCTCGGTGAGAGGGGGCTTCTCAGTGGTCGTCAG
CGACCCAATGCCACTGTCGAAGACGTTGTCGACTGCATGTGGGGTGTGATCAATAGGCTGTATGACGCCGGGGGA
CGTCGCTTCGTCATCTTCAACATGATACCGCTTGAGAAAGCGCCTCTGTACGGTGGGCCCGGATCCAAGGCCGCT
GAGAATCGCAACAAGCTGCGGAAGTATACGTCCTCTGTCAACGCCTTGCTGGGCGAGGACGCGCCGCAATTGCTT
CGGTGGCGATGGTCCGGTGCAACCTTGTCGTTACTCGACGTCCACTCTATAGTGACCGACGTCATTGCCAAACCG
AGCTGCTACCTGGATGCGCCGGCCAACTCTGCGATACCCTTCCATAACTGCGAGCCCCCTTGTTTCGACTCGCCC
GGCAAGCTGTCTAGCTACCTGTGGTACGATTCGCTTCACCCGTCGGCGAGGATAGAGGAGGTGTTTGGCCAGGAA
TTCATCAAACTCTTGCAGCAGGGGAACACCAAGTTCGGGAAGACATTCCAGGGATAA
Transcript >Ophun1|6228
ATGCCCACTTGTCCCGTCCAAGGAAACGCCGACCTCTACGGCCTCGGCATCCGCATCGGCCTGTACATCCAGATG
ATAACAGTCCAGCTCTCGGGCGTCCTCAGCGCCAGCTTCCGGGTAGAGGACCACATCGGACAAGGCACCATCATC
TTCGTCGCCTCAACCGTCATCATTCTAGTACGGCTCATCAACGCCAGCATCAGCAGCGCGACATCCGCAGACGAT
GACGCCGCTCTCGACGCCGTCGAAGTCTTCCCCGTTTTGACCCTCTTGCTCGTTCAGACGGGTGTGTGCCGCGTC
TCGTCACGCAACAGGCTGGCCATGCTCGTTTGGGTTGCTGAGCTCGTTGGCTTGGCTGCGCTGTACAACTATTTC
TGGTGGCGCGGCATGGACATGCTGCCGCGGTCGTGTCCGGACGACAAGGCCTTCTTCTTTGCTCGTGTCAGCATC
TGGGGCTGGTATCGAAGCCTCAACAAGGCGCTGGGAGTCTTTGCTGCCATTGGCGTTGCCTTTACGGTCGTCTCA
TTCTGCGGATCCGTCATCTACGAGCTCGTCCGCTGTGTCCTCTACCTCGTGGCGAGACAGGCCGACAATAGCAGC
ACCAGCGGCAGCAGCGTCGGCGCAAATGACGGATCCAGGGTCAAGCAAAAGCCCAGTCCGGCCATCGGGTCCATC
GATCTGCTGGCCAACGTCGGCGCAATCGTCTACGTCGAGGTCTCTTTGCGCTGGAACAGCATCACGGGCGTGCAC
TCCCTCGACAGCCCCGGCCAGTTCATGCCCCTGGTCATCGCCCTGGGCCAGTTCCTATCCGTCTTCTATTCGGCC
GCTAAGCAGCTGCTGGTGATGAACGCCAACGAGGACCTCGCCGGAGAGGAAGAGGATGATGCAGCCGAGTGTCAC
CACGCCATGTTCCATGCCGAACAGTACCCAGTGGCGGCCAACCGCAGCGGCGACCGCTGGCAAGCCCGTCTGCCC
GATGTCTCACGAACGACGACACTTTGCCTGGCTCTGCTGCTGCAGCTGAGCCGGGGCTTCAACCTCGTAACCTTT
GGCGACAGCTACACTGACGAGGGCCGGCTCCGATACATGCTCAAACATGGACGGGAGCCTCCGCCCGGCCTGATC
CTCTCTCCGTCCAGCCAGACCGCTAGCGGCGGCTTCAACTGGCCTCGCGTCGTTGCGCAGCGCACGGGGGCGAGC
TCCTACAACTTTGCCGTCTCCGGCGCCATGTGCTCCAATGATCTCGTGCCGGACCGCAAGCTGGACGCCACGGGG
GCGCCGTTCCCGTCTGTCTCCGGCTATGAGATGGATGCCTTCGAGGCTGCCGCTGCCATGGGCCGGATCGGGAGG
CCGCAGGAGACCGTTTATGCTCTTTGGATCGGCACCAACGACCTCGGTGAGAGGGGGCTTCTCAGTGGTCGTCAG
CGACCCAATGCCACTGTCGAAGACGTTGTCGACTGCATGTGGGGTGTGATCAATAGGCTGTATGACGCCGGGGGA
CGTCGCTTCGTCATCTTCAACATGATACCGCTTGAGAAAGCGCCTCTGTACGGTGGGCCCGGATCCAAGGCCGCT
GAGAATCGCAACAAGCTGCGGAAGTATACGTCCTCTGTCAACGCCTTGCTGGGCGAGGACGCGCCGCAATTGCTT
CGGTGGCGATGGTCCGGTGCAACCTTGTCGTTACTCGACGTCCACTCTATAGTGACCGACGTCATTGCCAAACCG
AGCTGCTACCTGGATGCGCCGGCCAACTCTGCGATACCCTTCCATAACTGCGAGCCCCCTTGTTTCGACTCGCCC
GGCAAGCTGTCTAGCTACCTGTGGTACGATTCGCTTCACCCGTCGGCGAGGATAGAGGAGGTGTTTGGCCAGGAA
TTCATCAAACTCTTGCAGCAGGGGAACACCAAGTTCGGGAAGACATTCCAGGGATAA
Gene >Ophun1|6228
ATGCCCACTTGTCCCGTCCAAGGAAACGCCGACCTCTACGGCCTCGGCATCCGCATCGGCCTGTACATCCAGATG
ATAACAGTCCAGCTCTCGGGCGTCCTCAGCGCCAGCTTCCGGGTAGAGGACCACATCGGACAAGGCACCATCATC
TTCGTCGCCTCAACCGTCATCATTCTAGTACGGCTCATCAACGCCAGCATCAGCAGCGCGACATCCGCAGACGAT
GACGCCGCTCTCGACGCCGTCGAAGTCTTCCCCGTTTTGACCCTCTTGCTCGTTCAGACGGGTGTGTGCCGCGTC
TCGTCACGCAACAGGCTGGCCATGCTCGTTTGGGTTGCTGAGCTCGTTGGCTTGGCTGCGCTGTACAACTATTTC
TGGTGGCGCGGCATGGACATGCTGCCGCGGTCGTGTCCGGACGACAAGGCCTTCTTCTTTGCTCGTGTCAGCATC
TGGGGCTGGTATCGAAGCCTCAACAAGGCGCTGGGAGTCTTTGCTGCCATTGGCGTTGCCTTTACGGTCGTCTCA
TTCTGCGGATGTGAGTTGCTCGCTCGTCTGGAGGAAAGGGGGCGAGCTGACAGGACCTTCAGCCGTCATCTACGA
GCTCGTCCGCTGTGTCCTCTACCTCGTGGCGAGACAGGCCGACAATAGCAGCACCAGCGGCAGCAGCGTCGGCGC
AAATGACGGATCCAGGGTCAAGCAAAAGCCCAGTCCGGCCATCGGGTCCATCGATCTGCTGGCCAACGTCGGCGC
AATCGTCTACGTCGAGGTCTCTTTGCGCTGGAACAGCATCACGGGCGTGCACTCCCTCGACAGCCCCGGCCAGTT
CATGCCCCTGGTCATCGCCCTGGGCCAGTTCCTATCCGTCTTCTATTCGGCCGCTAAGCAGCTGCTGGTGATGAA
CGCCAACGAGGACCTCGCCGGAGAGGAAGAGGGTGAGCGCTCATGTGAAGTGGACCCGTTTCTGAGCCTCGGCCT
GACAATGATATAGATGATGCAGCCGAGTGTCACCACGTGCGTGATGACAAAACGCTGCCTCTCGTCCAAACACAA
GCTGCCACGATATGAAGCTTCCGAGCCGGCGAATAAGAGTGTCGACGGCAGCAAATACGAAGGTATCACCACGTC
GCCGTTGGCCGACCTGACAGCTCGTACGCCTGCATCTTCTGAAAGCAAGGGGGGAGGTTCCGACGCCACGACCAG
CCACCGATCACTTGTCGCCGTCTTTACTCATATGAAAGGCCATGTTCCATGCCGAACAGTACCCAGTGGCGGCCA
ACCGCAGCGGCGACCGCTGGCAAGCCCGTCTGCCCGATGTCTCACGGTAGGCCCCGTGATTACCACAGATGCTCA
GCCGTGCAGTAGCTCGGCAAGACATGGGCTTCAGTCGTATCTATAAGAGAGACGAAATGCCGCCCTGCCATGTTC
ATCACCTGATAAGTCTCCCGGATACTTGTTGCCGAGATGAGGAGCAGAACGACGACACTTTGCCTGGCTCTGCTG
CTGCAGCTGAGCCGGGGCTTCAACCTCGTAACCTTTGGCGACAGCTACACTGACGAGGGCCGGCTCCGATACATG
CTCAAACATGGACGGGAGCCTCCGCCCGGCCTGATCCTCTCTCCGTCCAGCCAGACCGCTAGCGGCGGCTTCAAC
TGGCCTCGCGTCGTTGCGCAGCGCACGGGGGCGAGCTCCTACAACTTTGCCGTCTCCGGCGCCATGTGCTCCAAT
GATCTCGTGCCGGACCGCAAGCTGGACGCCACGGGGGCGCCGTTCCCGTCTGTCTCCGGCTATGAGATGGATGCC
TTCGAGGCTGCCGCTGCCATGGGCCGGATCGGGAGGCCGCAGGAGACCGTTTATGCTCTTTGGATCGGCACCAAC
GACCTCGGTGAGAGGGGGCTTCTCAGTGGTCGTCAGCGACCCAATGCCACTGTCGAAGACGTTGTCGACTGCATG
TGGGGTGTGATCAATAGGCTGTATGACGCCGGGGGACGTCGCTTCGTCATCTTCAACATGATACCGCTTGAGAAA
GCGCCTCTGTACGGTGGGCCCGGATCCAAGGCCGCTGAGAATCGCAACAAGCTGCGGAAGTATACGTCCTCTGTC
AACGCCTTGCTGGGCGAGGACGCGCCGCAATTGCTTCGGTGGCGATGGTCCGGTGCAACCTTGTCGTTACTCGAC
GTCCACTCTATAGTGACCGACGTCATTGCCAAACCGAGCTGCTACCTGGATGCGCCGGCCAACTCTGCGATACCC
TTCCATAACTGCGAGCCCCCTTGTTTCGACTCGCCCGGCAAGCTGTCTAGCTACCTGTGGTGGGTGACTTCTTTT
GGCATCCGTCATCTCGCCATGACCGCTGACTCAACTCGTTCTAGGTACGATTCGCTTCACCCGTCGGCGAGGATA
GAGGAGGTGTTTGGCCAGGAATTCATCAAACTCTTGCAGCAGGGGAACACCAAGTTCGGGAAGACATTCCAGGGA
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail