Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6220
Gene name
LocationContig_665:7937..9690
Strand+
Gene length (bp)1753
Transcript length (bp)837
Coding sequence length (bp)837
Protein length (aa) 279

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10215 Ost4 Oligosaccaryltransferase 1.7E-08 1 29
PF04969 CS CS domain 1.1E-06 118 190

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q11118|WOS2_SCHPO Protein wos2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wos2 PE=2 SV=1 103 260 1.0E-37
sp|P28707|SBA1_YEAST Co-chaperone protein SBA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SBA1 PE=1 SV=3 105 243 5.0E-24
sp|Q23280|DAF41_CAEEL Co-chaperone protein daf-41 OS=Caenorhabditis elegans GN=daf-41 PE=2 SV=1 106 218 6.0E-15
sp|Q6YYB0|Y8359_ORYSJ Uncharacterized protein Os08g0359500 OS=Oryza sativa subsp. japonica GN=Os08g0359500 PE=2 SV=1 106 235 2.0E-13
sp|P0C8Z0|Y8359_ORYSI Uncharacterized protein OsI_027940 OS=Oryza sativa subsp. indica GN=OsI_027940 PE=1 SV=2 106 235 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q11118|WOS2_SCHPO Protein wos2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wos2 PE=2 SV=1 103 260 1.0E-37
sp|P28707|SBA1_YEAST Co-chaperone protein SBA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SBA1 PE=1 SV=3 105 243 5.0E-24
sp|Q23280|DAF41_CAEEL Co-chaperone protein daf-41 OS=Caenorhabditis elegans GN=daf-41 PE=2 SV=1 106 218 6.0E-15
sp|Q6YYB0|Y8359_ORYSJ Uncharacterized protein Os08g0359500 OS=Oryza sativa subsp. japonica GN=Os08g0359500 PE=2 SV=1 106 235 2.0E-13
sp|P0C8Z0|Y8359_ORYSI Uncharacterized protein OsI_027940 OS=Oryza sativa subsp. indica GN=OsI_027940 PE=1 SV=2 106 235 2.0E-13
sp|Q6ID70|Y3377_ARATH Uncharacterized protein At3g03773 OS=Arabidopsis thaliana GN=At3g03773 PE=1 SV=1 103 235 6.0E-12
sp|Q90955|TEBP_CHICK Prostaglandin E synthase 3 (Fragment) OS=Gallus gallus GN=PTGES3 PE=1 SV=1 124 248 8.0E-12
sp|Q3ZBF7|TEBP_BOVIN Prostaglandin E synthase 3 OS=Bos taurus GN=PTGES3 PE=1 SV=1 119 248 1.0E-11
sp|Q15185|TEBP_HUMAN Prostaglandin E synthase 3 OS=Homo sapiens GN=PTGES3 PE=1 SV=1 119 248 1.0E-11
sp|Q6PWL5|TEBP_MACFA Prostaglandin E synthase 3 OS=Macaca fascicularis GN=PTGES3 PE=1 SV=1 119 248 1.0E-11
sp|Q5NVM4|TEBP_PONAB Prostaglandin E synthase 3 OS=Pongo abelii GN=PTGES3 PE=2 SV=1 119 248 1.0E-11
sp|P83868|TEBP_RAT Prostaglandin E synthase 3 OS=Rattus norvegicus GN=Ptges3 PE=1 SV=2 119 248 2.0E-11
sp|Q9R0Q7|TEBP_MOUSE Prostaglandin E synthase 3 OS=Mus musculus GN=Ptges3 PE=1 SV=1 119 248 2.0E-11
sp|Q9VH95|YC17_DROME Uncharacterized protein CG16817 OS=Drosophila melanogaster GN=CG16817 PE=1 SV=1 106 238 2.0E-11
sp|Q7SY06|HACD3_DANRE Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Danio rerio GN=hacd3 PE=2 SV=2 105 230 3.0E-08
sp|A7YY55|HACD3_BOVIN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Bos taurus GN=HACD3 PE=2 SV=1 102 223 3.0E-07
sp|Q9P035|HACD3_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Homo sapiens GN=HACD3 PE=1 SV=2 102 223 2.0E-06
sp|Q8K2C9|HACD3_MOUSE Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Mus musculus GN=Hacd3 PE=1 SV=2 101 223 2.0E-06
sp|Q5ZM57|HACD3_CHICK Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Gallus gallus GN=HACD3 PE=2 SV=1 100 223 4.0E-06
sp|Q5NVQ2|HACD3_PONAB Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Pongo abelii GN=HACD3 PE=2 SV=1 102 223 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6220
MISDRELFSIAIFTGAASMLLIVLQHFLQHECAIVTVFVKKTSGPSEWLRPGRGLPPPNPWQRSITFHPVLFFTA
RCIFWLPAHSTLLSKAPQKPVQKTMAETATPEVLWAQRSSVSDEAKNFIYLTISVPDIPKDGLKLDLQPTKLDFT
GTSGTLKRKYHLELDFYGEIDPKESKINHTSKNIEMKLQKKELKEEYWPRLLKDKKKLHFLKTDFDKWVDEDEQN
EAVEEDFSQFGGMGAGGMPGMGGMGGMPGMGGMGGNVAPVPPLLFPSLKTRKS*
Coding >Ophun1|6220
ATGATCTCCGACCGAGAGCTGTTTAGCATTGCCATCTTCACCGGTGCCGCCTCCATGCTCCTGATTGTATTGCAA
CACTTTCTACAGCACGAGTGCGCCATCGTCACCGTCTTTGTGAAGAAGACGAGCGGGCCGTCAGAGTGGCTCCGG
CCTGGTCGAGGCTTGCCCCCGCCCAACCCCTGGCAGCGCTCCATCACCTTCCATCCAGTGCTCTTCTTCACTGCA
CGCTGCATCTTTTGGCTTCCGGCGCATTCTACACTCCTCTCCAAAGCACCGCAAAAGCCCGTTCAGAAAACAATG
GCTGAGACGGCAACCCCCGAAGTCCTCTGGGCGCAGAGATCGTCCGTCTCGGACGAGGCCAAGAACTTCATCTAC
CTGACCATCTCCGTCCCCGACATCCCCAAGGACGGTCTCAAGCTCGATCTGCAGCCCACCAAGCTCGACTTCACC
GGCACGTCCGGCACCCTCAAGCGAAAGTACCACCTCGAGCTCGACTTTTACGGCGAAATCGACCCCAAAGAGAGC
AAAATCAACCACACCTCCAAGAACATCGAGATGAAGCTGCAGAAGAAGGAGCTCAAGGAGGAGTACTGGCCGCGG
CTGCTCAAGGACAAGAAGAAACTCCACTTCCTCAAGACCGACTTCGACAAGTGGGTCGACGAAGACGAGCAGAAC
GAGGCGGTCGAAGAAGACTTTTCACAGTTCGGCGGAATGGGCGCAGGCGGCATGCCCGGCATGGGTGGCATGGGC
GGCATGCCCGGTATGGGCGGTATGGGCGGTAACGTGGCACCCGTCCCCCCCCTTTTGTTTCCCTCTCTCAAGACA
CGCAAAAGCTGA
Transcript >Ophun1|6220
ATGATCTCCGACCGAGAGCTGTTTAGCATTGCCATCTTCACCGGTGCCGCCTCCATGCTCCTGATTGTATTGCAA
CACTTTCTACAGCACGAGTGCGCCATCGTCACCGTCTTTGTGAAGAAGACGAGCGGGCCGTCAGAGTGGCTCCGG
CCTGGTCGAGGCTTGCCCCCGCCCAACCCCTGGCAGCGCTCCATCACCTTCCATCCAGTGCTCTTCTTCACTGCA
CGCTGCATCTTTTGGCTTCCGGCGCATTCTACACTCCTCTCCAAAGCACCGCAAAAGCCCGTTCAGAAAACAATG
GCTGAGACGGCAACCCCCGAAGTCCTCTGGGCGCAGAGATCGTCCGTCTCGGACGAGGCCAAGAACTTCATCTAC
CTGACCATCTCCGTCCCCGACATCCCCAAGGACGGTCTCAAGCTCGATCTGCAGCCCACCAAGCTCGACTTCACC
GGCACGTCCGGCACCCTCAAGCGAAAGTACCACCTCGAGCTCGACTTTTACGGCGAAATCGACCCCAAAGAGAGC
AAAATCAACCACACCTCCAAGAACATCGAGATGAAGCTGCAGAAGAAGGAGCTCAAGGAGGAGTACTGGCCGCGG
CTGCTCAAGGACAAGAAGAAACTCCACTTCCTCAAGACCGACTTCGACAAGTGGGTCGACGAAGACGAGCAGAAC
GAGGCGGTCGAAGAAGACTTTTCACAGTTCGGCGGAATGGGCGCAGGCGGCATGCCCGGCATGGGTGGCATGGGC
GGCATGCCCGGTATGGGCGGTATGGGCGGTAACGTGGCACCCGTCCCCCCCCTTTTGTTTCCCTCTCTCAAGACA
CGCAAAAGCTGA
Gene >Ophun1|6220
ATGATCTCCGACCGAGAGCTGTTTAGCATTGCCATCTTCACCGGTGCCGCCTCCATGCTCCTGATTGTATTGCAA
CACTTTCTACAGGTCCGCACGGGTACCGAATCACACATCGTCAAGGCGAAATGAAGGACGAAAGCGACAAGAACC
GCGCGCGGCGCATCGGGAGAAGCTGCCGGCTTGAGAGTTCGGAACGATGGCCTACATGTTACGAATATTTGTGCG
AATACACTGAACGATGGAGCTGGCAGCGGCAAAAAGGGTGGCTGCGTAGGAGCTAGTTCATATCATGATCAACAT
GCAAAGCACGAGTGCGCCATCGTCACCGTCTTTGTGAAGAAGACGAGCGGGCCGTCAGAGTGGCTCCGGCCTGGG
TATGACGATGAGACGTCAGTCGCAATACACCTTGACAGCAGGCTGCATATCTACAGAAAACAAGTGAAAGTAAAG
TCGTCTTTGCTCGCCGAGACTCGGACTCGGAAAGGCACTCATCACTCCCGCCCCGTCATCGGCGACGCAGCCGGC
TCTACTGCGGCCATAGCAGTTTACGCCACACCTGAAGCCAGCTGTGGAGCCACAAGTCCCACCTGCTAGTCCCCC
ATAACCTTACCACGCCCACCACGCAGCAATCGCCGACTCCTGCACTAACGCCATCGACGCAGTCGAGGCTTGCCC
CCGCCCAACCCCTGGCAGCGCTCCATCACCTTCCATCCAGTGCTCTTCTTCACTGCACGCTGCATCTTTTGGCTT
CCGGCGCATTCTACACTCCTCGTCCGCCTTAGTCATTCGGTTAGTCTAGGTTGGTTCGCGCCGCGGCTCTGCCGT
TGCTTGTTCCTCATTAAGCATCCAGCTCAAGCTTTTTTTTATTCTTGCTTGTTGTTGACCGACTTGTTTTCCCAC
GACGTACGTGATCTTCCTCGCCTCTCGAAAAATCTCTGACTTTCAAAGTCTTTTCCTCGTCTTCTCCTCTCGTCA
CTCGCCATTTGTTGACATACATACAGCTTTCCCAGTCCAGCAACCAATTCTCTACCCCCCCTCTTCACCAAACCA
CACTCCCCAAGTCCAAAGCACCGCAAAAGCCCGTTCAGAAAACAATGGCTGAGACGGCAACCCCCGAAGGTCCGT
CAGCTAGCATCTCCCCACACCCCATGGTCCGCGGCTGACGCGACACAGTCCTCTGGGCGCAGAGATCGTCCGTCT
CGGACGAGGCCAAGAACTTCATCTACCTGACCATCTCCGTCCCCGACATCCCCAAGGACGGTCTCAAGCTCGATC
TGCAGCCCACCAAGCTCGACTTCACCGGCACGTCCGGCACCCTCAAGCGAAAGTACCACCTCGAGCTCGACTTTT
ACGGCGAAATCGACCCCAAAGAGAGCAAAATCAACCACACCTCCAAGAACATCGAGATGAAGCTGCAGAAGAAGG
AGCTCAAGGAGGAGTACTGGCCGCGGCTGCTCAAGGACAAGAAGAAACTCCACTTCCTCAAGACCGACTTCGACA
AGTGGGTCGACGAAGACGAGCAGAACGAGGCGGTCGAAGAAGACTTTTCACAGTTCGGCGGAATGGGTTCGTACT
CTCCCACACCATCACCCGAGGCTCAACAAAAAAACTAACTGACGGCGTCACCACAGGCGCAGGCGGCATGCCCGG
CATGGGTGGCATGGGCGGCATGCCCGGTATGGGCGGTATGGGCGGTAACGTGGCACCCGTCCCCCCCCTTTTGTT
TCCCTCTCTCAAGACACGCAAAAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail