Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6215
Gene name
LocationContig_664:2977..4438
Strand+
Gene length (bp)1461
Transcript length (bp)1461
Coding sequence length (bp)1461
Protein length (aa) 487

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00206 Lyase_1 Lyase 2.2E-26 41 303
PF10397 ADSL_C Adenylosuccinate lyase C-terminus 1.6E-12 376 458

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05911|PUR8_YEAST Adenylosuccinate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE13 PE=1 SV=1 1 458 2.0E-180
sp|O60105|PUR8_SCHPO Adenylosuccinate lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade8 PE=3 SV=1 5 480 2.0E-174
sp|P30566|PUR8_HUMAN Adenylosuccinate lyase OS=Homo sapiens GN=ADSL PE=1 SV=2 3 458 2.0E-173
sp|Q8HXY5|PUR8_MACFA Adenylosuccinate lyase OS=Macaca fascicularis GN=ADSL PE=2 SV=1 3 458 5.0E-173
sp|P54822|PUR8_MOUSE Adenylosuccinate lyase OS=Mus musculus GN=Adsl PE=1 SV=2 2 458 6.0E-173
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05911|PUR8_YEAST Adenylosuccinate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE13 PE=1 SV=1 1 458 2.0E-180
sp|O60105|PUR8_SCHPO Adenylosuccinate lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade8 PE=3 SV=1 5 480 2.0E-174
sp|P30566|PUR8_HUMAN Adenylosuccinate lyase OS=Homo sapiens GN=ADSL PE=1 SV=2 3 458 2.0E-173
sp|Q8HXY5|PUR8_MACFA Adenylosuccinate lyase OS=Macaca fascicularis GN=ADSL PE=2 SV=1 3 458 5.0E-173
sp|P54822|PUR8_MOUSE Adenylosuccinate lyase OS=Mus musculus GN=Adsl PE=1 SV=2 2 458 6.0E-173
sp|A3KN12|PUR8_BOVIN Adenylosuccinate lyase OS=Bos taurus GN=ADSL PE=2 SV=1 6 458 5.0E-169
sp|P21265|PUR8_CHICK Adenylosuccinate lyase OS=Gallus gallus GN=ADSL PE=2 SV=2 8 458 3.0E-166
sp|Q21774|PUR8_CAEEL Adenylosuccinate lyase OS=Caenorhabditis elegans GN=adsl-1 PE=1 SV=1 3 458 1.0E-119
sp|Q60Q90|PUR8_CAEBR Adenylosuccinate lyase OS=Caenorhabditis briggsae GN=CBG21917 PE=3 SV=1 3 458 2.0E-119
sp|Q9UZ99|PUR8_PYRAB Adenylosuccinate lyase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=purB PE=3 SV=1 11 460 1.0E-44
sp|O58582|PUR8_PYRHO Adenylosuccinate lyase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=purB PE=3 SV=1 11 457 2.0E-43
sp|O66856|PUR8_AQUAE Adenylosuccinate lyase OS=Aquifex aeolicus (strain VF5) GN=purB PE=3 SV=1 12 408 8.0E-40
sp|O27580|PUR8_METTH Adenylosuccinate lyase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=purB PE=3 SV=1 11 458 1.0E-38
sp|O28041|PUR8_ARCFU Adenylosuccinate lyase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=purB PE=3 SV=1 11 457 6.0E-38
sp|P74384|PUR8_SYNY3 Adenylosuccinate lyase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=purB PE=3 SV=1 12 429 2.0E-37
sp|P12047|PUR8_BACSU Adenylosuccinate lyase OS=Bacillus subtilis (strain 168) GN=purB PE=1 SV=1 12 408 1.0E-36
sp|Q58339|PUR8_METJA Adenylosuccinate lyase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=purB PE=3 SV=1 11 458 1.0E-33
sp|P72478|PUR8_STRMU Adenylosuccinate lyase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=purB PE=3 SV=2 12 402 3.0E-33
sp|Q4L7M3|PUR8_STAHJ Adenylosuccinate lyase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=purB PE=3 SV=1 12 408 9.0E-33
sp|Q2FFI7|PUR8_STAA3 Adenylosuccinate lyase OS=Staphylococcus aureus (strain USA300) GN=purB PE=3 SV=1 12 402 1.0E-32
sp|Q2G2S0|PUR8_STAA8 Adenylosuccinate lyase OS=Staphylococcus aureus (strain NCTC 8325) GN=purB PE=3 SV=1 12 402 1.0E-32
sp|Q2YU66|PUR8_STAAB Adenylosuccinate lyase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=purB PE=3 SV=1 12 402 1.0E-32
sp|Q5HEL4|PUR8_STAAC Adenylosuccinate lyase OS=Staphylococcus aureus (strain COL) GN=purB PE=3 SV=1 12 402 1.0E-32
sp|Q7A4Q3|PUR8_STAAN Adenylosuccinate lyase OS=Staphylococcus aureus (strain N315) GN=purB PE=1 SV=1 12 402 1.0E-32
sp|Q99SX9|PUR8_STAAM Adenylosuccinate lyase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=purB PE=3 SV=1 12 402 1.0E-32
sp|Q7A0G9|PUR8_STAAW Adenylosuccinate lyase OS=Staphylococcus aureus (strain MW2) GN=purB PE=1 SV=1 12 402 1.0E-32
sp|Q6G825|PUR8_STAAS Adenylosuccinate lyase OS=Staphylococcus aureus (strain MSSA476) GN=purB PE=3 SV=1 12 402 1.0E-32
sp|Q6GFE9|PUR8_STAAR Adenylosuccinate lyase OS=Staphylococcus aureus (strain MRSA252) GN=purB PE=3 SV=1 12 402 1.0E-32
sp|Q49YV3|PUR8_STAS1 Adenylosuccinate lyase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=purB PE=3 SV=1 12 408 2.0E-32
sp|Q8CRT6|PUR8_STAES Adenylosuccinate lyase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=purB PE=3 SV=1 12 408 4.0E-32
sp|Q5HN26|PUR8_STAEQ Adenylosuccinate lyase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=purB PE=3 SV=1 12 408 4.0E-32
sp|Q9RSE6|PUR8_DEIRA Adenylosuccinate lyase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=purB PE=3 SV=1 12 364 3.0E-30
sp|P56468|PUR8_HELPY Adenylosuccinate lyase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=purB PE=3 SV=1 12 402 1.0E-28
sp|Q9X0I0|PUR8_THEMA Adenylosuccinate lyase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=purB PE=1 SV=1 12 402 2.0E-28
sp|Q9ZKA2|PUR8_HELPJ Adenylosuccinate lyase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=purB PE=3 SV=1 12 402 6.0E-28
sp|Q59092|PCAB_ACIAD 3-carboxy-cis,cis-muconate cycloisomerase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaB PE=1 SV=2 14 456 2.0E-21
sp|P32427|PCAB_PSEPU 3-carboxy-cis,cis-muconate cycloisomerase (Fragment) OS=Pseudomonas putida GN=pcaB PE=1 SV=3 5 329 6.0E-11
sp|O17214|FUMH_CAEEL Probable fumarate hydratase, mitochondrial OS=Caenorhabditis elegans GN=fum-1 PE=3 SV=1 123 408 1.0E-09
sp|Q5ZXD1|PUR8_LEGPH Adenylosuccinate lyase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=purB PE=1 SV=1 79 336 2.0E-09
sp|A5IGB3|PUR8_LEGPC Adenylosuccinate lyase OS=Legionella pneumophila (strain Corby) GN=purB PE=3 SV=1 79 336 3.0E-09
sp|Q54J34|PUR8_DICDI Adenylosuccinate lyase OS=Dictyostelium discoideum GN=purB PE=3 SV=1 79 340 1.0E-08
sp|O31385|PCAB_BRADU 3-carboxy-cis,cis-muconate cycloisomerase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=pcaB PE=3 SV=1 100 371 2.0E-08
sp|Q9KCX4|FUMC_BACHD Fumarate hydratase class II OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=fumC PE=3 SV=1 127 382 9.0E-08
sp|Q8Y551|FUMC_LISMO Fumarate hydratase class II OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=fumC PE=3 SV=1 129 382 2.0E-07
sp|P39461|FUMC_SULSO Fumarate hydratase class II OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fumC PE=1 SV=1 129 300 2.0E-07
sp|Q9I0K9|PUR8_PSEAE Adenylosuccinate lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=purB PE=3 SV=1 79 336 2.0E-07
sp|Q89AM3|PUR8_BUCBP Adenylosuccinate lyase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=purB PE=3 SV=1 79 336 3.0E-07
sp|Q8FX90|FUMC_BRUSU Fumarate hydratase class II OS=Brucella suis biovar 1 (strain 1330) GN=fumC PE=3 SV=1 124 408 3.0E-07
sp|Q8YB50|FUMC_BRUME Fumarate hydratase class II OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=fumC PE=3 SV=2 124 408 3.0E-07
sp|P07343|FUMC_BACSU Fumarate hydratase class II OS=Bacillus subtilis (strain 168) GN=fumC PE=3 SV=2 129 433 3.0E-07
sp|Q929E8|FUMC_LISIN Fumarate hydratase class II OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=fumC PE=3 SV=1 70 382 6.0E-07
sp|Q9RR70|FUMC_DEIRA Fumarate hydratase class II OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=fumC PE=3 SV=1 129 375 1.0E-06
sp|O25883|FUMC_HELPY Fumarate hydratase class II OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=fumC PE=3 SV=1 129 360 3.0E-06
sp|Q9CJ76|ARLY_LACLA Argininosuccinate lyase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=argH PE=3 SV=1 56 361 4.0E-06
sp|Q31JG7|ARLY_THICR Argininosuccinate lyase OS=Thiomicrospira crunogena (strain XCL-2) GN=argH PE=3 SV=1 120 406 6.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5691
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2061
Ophiocordyceps australis map64 (Brazil) OphauB2|3190
Ophiocordyceps camponoti-floridani Ophcf2|00508
Ophiocordyceps camponoti-rufipedis Ophun1|6215 (this protein)
Ophiocordyceps kimflemingae Ophio5|3733
Ophiocordyceps subramaniannii Hirsu2|8622

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6215
MPASFDEYQTPLVSRYTSREMISIFSPRQRISTWRKLWLWLAEAEKELGLTKITDEAIDALRSSLAVGDHVFKVA
ADEERRVRHDVMAHIHALEKDAPAAAGLIHIGATSCYVTDNADLIFLRDALDLLLPKLARAMSSLSKFACQYKDL
PTLGFTHYQAAQPITLGRRAAQWLQDFLMDLEDIEYVRAGLRFRGAQGTTGTQASFMELFQNDTAKIDKLNEMLC
QKAGFPSCYDISTQTYSRKVDLRVANALSALGATATRVATDIRHLCHDKVLDEPHVAAQIGSSAMPFKSNPMTAE
RICSLGRKLSNMASAFSETFSQQWLERSLDDSAIRRMDIPEMFFLADAIVTSLDHVFSGLVVFPAIVKSQLMQEL
PFMATENILIRMINHGASRQVAHEQIRLLAHEAACHVKMEGGSNDLIERIKRTDFFKPIWGEVDGLMKPELFVGR
CAEQVDKFAGPGGVVEGRLAKYRQHIEGSKATQLAV*
Coding >Ophun1|6215
ATGCCTGCTTCCTTCGACGAGTACCAGACGCCGCTGGTGTCCCGCTACACCAGCAGGGAGATGATCAGCATCTTC
TCGCCGAGGCAACGCATCTCGACATGGCGAAAGCTCTGGCTGTGGCTCGCAGAGGCTGAGAAAGAGCTCGGCCTG
ACGAAAATCACCGACGAGGCCATCGACGCCCTCCGCTCCAGCCTAGCCGTCGGCGACCATGTCTTCAAGGTGGCC
GCCGACGAGGAGCGCCGCGTCCGACACGACGTCATGGCCCATATCCACGCCCTGGAAAAGGACGCTCCCGCCGCT
GCTGGCCTCATCCACATCGGGGCAACCTCATGCTACGTCACCGACAACGCCGACCTCATCTTCCTCCGCGATGCC
CTCGACCTCTTGCTGCCCAAGCTGGCCCGGGCCATGAGCTCCCTGTCCAAGTTTGCCTGCCAGTACAAGGACCTG
CCCACGCTCGGCTTCACTCACTATCAGGCCGCTCAGCCCATAACCCTCGGACGCCGCGCGGCTCAGTGGCTGCAA
GATTTCCTCATGGATCTCGAAGATATCGAGTACGTCCGGGCCGGGCTGCGGTTCCGCGGCGCCCAGGGCACCACC
GGCACCCAGGCATCCTTTATGGAACTCTTCCAGAACGATACCGCCAAGATCGACAAGCTCAACGAGATGCTTTGC
CAAAAGGCCGGCTTCCCCAGCTGCTACGACATCTCGACACAGACCTACAGCCGCAAAGTCGACCTCCGCGTCGCC
AATGCGCTGTCGGCGCTCGGGGCCACGGCGACTCGCGTCGCGACCGACATACGCCACCTCTGCCACGACAAGGTC
TTGGACGAGCCTCACGTGGCCGCGCAGATTGGCTCGTCGGCTATGCCCTTCAAGTCGAACCCGATGACGGCCGAG
CGCATCTGCAGCTTGGGCCGCAAGCTCAGCAACATGGCGTCTGCCTTTAGCGAGACCTTTTCGCAGCAGTGGTTG
GAGCGCAGCCTCGACGACAGCGCGATCCGGCGCATGGACATACCCGAGATGTTCTTCTTGGCCGACGCCATCGTC
ACCAGCCTCGACCACGTCTTCAGCGGGCTGGTCGTCTTCCCCGCCATCGTCAAGTCGCAGCTGATGCAGGAGCTG
CCGTTCATGGCGACGGAGAACATCCTGATCCGCATGATCAACCACGGAGCGTCGCGACAGGTGGCGCACGAGCAG
ATCCGGCTGCTGGCGCACGAGGCGGCCTGCCACGTCAAGATGGAGGGCGGCAGCAACGACCTCATCGAGCGCATC
AAGCGGACCGACTTCTTCAAGCCCATCTGGGGCGAGGTGGACGGACTGATGAAGCCCGAGCTGTTCGTCGGCCGC
TGTGCCGAGCAGGTGGACAAGTTTGCCGGGCCGGGTGGCGTCGTCGAGGGACGTCTGGCCAAGTATAGACAGCAT
ATTGAGGGTAGCAAGGCGACTCAACTTGCCGTCTGA
Transcript >Ophun1|6215
ATGCCTGCTTCCTTCGACGAGTACCAGACGCCGCTGGTGTCCCGCTACACCAGCAGGGAGATGATCAGCATCTTC
TCGCCGAGGCAACGCATCTCGACATGGCGAAAGCTCTGGCTGTGGCTCGCAGAGGCTGAGAAAGAGCTCGGCCTG
ACGAAAATCACCGACGAGGCCATCGACGCCCTCCGCTCCAGCCTAGCCGTCGGCGACCATGTCTTCAAGGTGGCC
GCCGACGAGGAGCGCCGCGTCCGACACGACGTCATGGCCCATATCCACGCCCTGGAAAAGGACGCTCCCGCCGCT
GCTGGCCTCATCCACATCGGGGCAACCTCATGCTACGTCACCGACAACGCCGACCTCATCTTCCTCCGCGATGCC
CTCGACCTCTTGCTGCCCAAGCTGGCCCGGGCCATGAGCTCCCTGTCCAAGTTTGCCTGCCAGTACAAGGACCTG
CCCACGCTCGGCTTCACTCACTATCAGGCCGCTCAGCCCATAACCCTCGGACGCCGCGCGGCTCAGTGGCTGCAA
GATTTCCTCATGGATCTCGAAGATATCGAGTACGTCCGGGCCGGGCTGCGGTTCCGCGGCGCCCAGGGCACCACC
GGCACCCAGGCATCCTTTATGGAACTCTTCCAGAACGATACCGCCAAGATCGACAAGCTCAACGAGATGCTTTGC
CAAAAGGCCGGCTTCCCCAGCTGCTACGACATCTCGACACAGACCTACAGCCGCAAAGTCGACCTCCGCGTCGCC
AATGCGCTGTCGGCGCTCGGGGCCACGGCGACTCGCGTCGCGACCGACATACGCCACCTCTGCCACGACAAGGTC
TTGGACGAGCCTCACGTGGCCGCGCAGATTGGCTCGTCGGCTATGCCCTTCAAGTCGAACCCGATGACGGCCGAG
CGCATCTGCAGCTTGGGCCGCAAGCTCAGCAACATGGCGTCTGCCTTTAGCGAGACCTTTTCGCAGCAGTGGTTG
GAGCGCAGCCTCGACGACAGCGCGATCCGGCGCATGGACATACCCGAGATGTTCTTCTTGGCCGACGCCATCGTC
ACCAGCCTCGACCACGTCTTCAGCGGGCTGGTCGTCTTCCCCGCCATCGTCAAGTCGCAGCTGATGCAGGAGCTG
CCGTTCATGGCGACGGAGAACATCCTGATCCGCATGATCAACCACGGAGCGTCGCGACAGGTGGCGCACGAGCAG
ATCCGGCTGCTGGCGCACGAGGCGGCCTGCCACGTCAAGATGGAGGGCGGCAGCAACGACCTCATCGAGCGCATC
AAGCGGACCGACTTCTTCAAGCCCATCTGGGGCGAGGTGGACGGACTGATGAAGCCCGAGCTGTTCGTCGGCCGC
TGTGCCGAGCAGGTGGACAAGTTTGCCGGGCCGGGTGGCGTCGTCGAGGGACGTCTGGCCAAGTATAGACAGCAT
ATTGAGGGTAGCAAGGCGACTCAACTTGCCGTCTGA
Gene >Ophun1|6215
ATGCCTGCTTCCTTCGACGAGTACCAGACGCCGCTGGTGTCCCGCTACACCAGCAGGGAGATGATCAGCATCTTC
TCGCCGAGGCAACGCATCTCGACATGGCGAAAGCTCTGGCTGTGGCTCGCAGAGGCTGAGAAAGAGCTCGGCCTG
ACGAAAATCACCGACGAGGCCATCGACGCCCTCCGCTCCAGCCTAGCCGTCGGCGACCATGTCTTCAAGGTGGCC
GCCGACGAGGAGCGCCGCGTCCGACACGACGTCATGGCCCATATCCACGCCCTGGAAAAGGACGCTCCCGCCGCT
GCTGGCCTCATCCACATCGGGGCAACCTCATGCTACGTCACCGACAACGCCGACCTCATCTTCCTCCGCGATGCC
CTCGACCTCTTGCTGCCCAAGCTGGCCCGGGCCATGAGCTCCCTGTCCAAGTTTGCCTGCCAGTACAAGGACCTG
CCCACGCTCGGCTTCACTCACTATCAGGCCGCTCAGCCCATAACCCTCGGACGCCGCGCGGCTCAGTGGCTGCAA
GATTTCCTCATGGATCTCGAAGATATCGAGTACGTCCGGGCCGGGCTGCGGTTCCGCGGCGCCCAGGGCACCACC
GGCACCCAGGCATCCTTTATGGAACTCTTCCAGAACGATACCGCCAAGATCGACAAGCTCAACGAGATGCTTTGC
CAAAAGGCCGGCTTCCCCAGCTGCTACGACATCTCGACACAGACCTACAGCCGCAAAGTCGACCTCCGCGTCGCC
AATGCGCTGTCGGCGCTCGGGGCCACGGCGACTCGCGTCGCGACCGACATACGCCACCTCTGCCACGACAAGGTC
TTGGACGAGCCTCACGTGGCCGCGCAGATTGGCTCGTCGGCTATGCCCTTCAAGTCGAACCCGATGACGGCCGAG
CGCATCTGCAGCTTGGGCCGCAAGCTCAGCAACATGGCGTCTGCCTTTAGCGAGACCTTTTCGCAGCAGTGGTTG
GAGCGCAGCCTCGACGACAGCGCGATCCGGCGCATGGACATACCCGAGATGTTCTTCTTGGCCGACGCCATCGTC
ACCAGCCTCGACCACGTCTTCAGCGGGCTGGTCGTCTTCCCCGCCATCGTCAAGTCGCAGCTGATGCAGGAGCTG
CCGTTCATGGCGACGGAGAACATCCTGATCCGCATGATCAACCACGGAGCGTCGCGACAGGTGGCGCACGAGCAG
ATCCGGCTGCTGGCGCACGAGGCGGCCTGCCACGTCAAGATGGAGGGCGGCAGCAACGACCTCATCGAGCGCATC
AAGCGGACCGACTTCTTCAAGCCCATCTGGGGCGAGGTGGACGGACTGATGAAGCCCGAGCTGTTCGTCGGCCGC
TGTGCCGAGCAGGTGGACAAGTTTGCCGGGCCGGGTGGCGTCGTCGAGGGACGTCTGGCCAAGTATAGACAGCAT
ATTGAGGGTAGCAAGGCGACTCAACTTGCCGTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail