Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6209
Gene name
LocationContig_663:156..717
Strand+
Gene length (bp)561
Transcript length (bp)561
Coding sequence length (bp)561
Protein length (aa) 187

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13419 HAD_2 Haloacid dehalogenase-like hydrolase 1.2E-15 29 142

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P31467|YIEH_ECOLI 6-phosphogluconate phosphatase OS=Escherichia coli (strain K12) GN=yieH PE=1 SV=1 3 158 5.0E-09

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup471
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2267
Ophiocordyceps australis map64 (Brazil) OphauB2|6005
Ophiocordyceps camponoti-floridani Ophcf2|06791
Ophiocordyceps camponoti-rufipedis Ophun1|6209 (this protein)
Ophiocordyceps kimflemingae Ophio5|6811
Ophiocordyceps subramaniannii Hirsu2|10371
Ophiocordyceps subramaniannii Hirsu2|3539
Ophiocordyceps subramaniannii Hirsu2|5668

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6209
MLTTLQREYAIDINPDDMEKYVRMEEDAVIAKLKASLRPCDGVDAQLKELDASGKYLMAVVSSSAFRRLRASIEK
VGQEKYFPEDRVFSAATSLEKPTSKPDPAVYLHALKKLGRTAEESVAIEDSKSGTLSGTRAQIKVVGYVGPYPDD
KKAEMEKVLRDAGAVIIMRDWSEFPACLKKIEAGEC*
Coding >Ophun1|6209
ATGCTCACCACCCTCCAGCGCGAATACGCCATCGACATCAACCCGGACGACATGGAAAAGTACGTCCGCATGGAG
GAGGACGCCGTCATCGCAAAGCTCAAGGCCTCGCTTCGTCCCTGCGACGGCGTCGACGCTCAGCTCAAGGAGCTG
GATGCTTCGGGCAAATATCTCATGGCCGTCGTCTCCTCGTCGGCTTTCCGTCGTCTTCGCGCTTCCATTGAAAAG
GTCGGGCAGGAAAAGTACTTTCCCGAAGATCGCGTCTTCTCCGCCGCTACCAGCTTGGAGAAGCCCACCAGCAAG
CCCGATCCCGCCGTCTATCTGCACGCCCTCAAGAAGCTCGGTCGTACGGCCGAGGAGAGCGTCGCCATTGAGGAT
AGCAAGAGCGGCACTCTCAGCGGGACGCGTGCTCAGATCAAGGTCGTCGGCTACGTTGGGCCCTATCCGGATGAC
AAAAAGGCCGAGATGGAAAAGGTGTTGCGGGATGCGGGCGCCGTCATCATCATGCGTGACTGGTCCGAGTTCCCG
GCCTGTCTGAAGAAGATTGAGGCTGGCGAGTGCTAG
Transcript >Ophun1|6209
ATGCTCACCACCCTCCAGCGCGAATACGCCATCGACATCAACCCGGACGACATGGAAAAGTACGTCCGCATGGAG
GAGGACGCCGTCATCGCAAAGCTCAAGGCCTCGCTTCGTCCCTGCGACGGCGTCGACGCTCAGCTCAAGGAGCTG
GATGCTTCGGGCAAATATCTCATGGCCGTCGTCTCCTCGTCGGCTTTCCGTCGTCTTCGCGCTTCCATTGAAAAG
GTCGGGCAGGAAAAGTACTTTCCCGAAGATCGCGTCTTCTCCGCCGCTACCAGCTTGGAGAAGCCCACCAGCAAG
CCCGATCCCGCCGTCTATCTGCACGCCCTCAAGAAGCTCGGTCGTACGGCCGAGGAGAGCGTCGCCATTGAGGAT
AGCAAGAGCGGCACTCTCAGCGGGACGCGTGCTCAGATCAAGGTCGTCGGCTACGTTGGGCCCTATCCGGATGAC
AAAAAGGCCGAGATGGAAAAGGTGTTGCGGGATGCGGGCGCCGTCATCATCATGCGTGACTGGTCCGAGTTCCCG
GCCTGTCTGAAGAAGATTGAGGCTGGCGAGTGCTAG
Gene >Ophun1|6209
ATGCTCACCACCCTCCAGCGCGAATACGCCATCGACATCAACCCGGACGACATGGAAAAGTACGTCCGCATGGAG
GAGGACGCCGTCATCGCAAAGCTCAAGGCCTCGCTTCGTCCCTGCGACGGCGTCGACGCTCAGCTCAAGGAGCTG
GATGCTTCGGGCAAATATCTCATGGCCGTCGTCTCCTCGTCGGCTTTCCGTCGTCTTCGCGCTTCCATTGAAAAG
GTCGGGCAGGAAAAGTACTTTCCCGAAGATCGCGTCTTCTCCGCCGCTACCAGCTTGGAGAAGCCCACCAGCAAG
CCCGATCCCGCCGTCTATCTGCACGCCCTCAAGAAGCTCGGTCGTACGGCCGAGGAGAGCGTCGCCATTGAGGAT
AGCAAGAGCGGCACTCTCAGCGGGACGCGTGCTCAGATCAAGGTCGTCGGCTACGTTGGGCCCTATCCGGATGAC
AAAAAGGCCGAGATGGAAAAGGTGTTGCGGGATGCGGGCGCCGTCATCATCATGCGTGACTGGTCCGAGTTCCCG
GCCTGTCTGAAGAAGATTGAGGCTGGCGAGTGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail