Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6208
Gene name
LocationContig_662:7674..9847
Strand+
Gene length (bp)2173
Transcript length (bp)1932
Coding sequence length (bp)1932
Protein length (aa) 644

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09794 Avl9 Transport protein Avl9 2.0E-145 22 399

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12500|AVL9_YEAST Late secretory pathway protein AVL9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVL9 PE=1 SV=1 22 470 2.0E-117
sp|O13943|AVL9_SCHPO Late secretory pathway protein avl9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avl9 PE=3 SV=2 22 457 1.0E-98
sp|Q5R991|AVL9_PONAB Late secretory pathway protein AVL9 homolog OS=Pongo abelii GN=AVL9 PE=2 SV=1 12 263 1.0E-40
sp|Q8NBF6|AVL9_HUMAN Late secretory pathway protein AVL9 homolog OS=Homo sapiens GN=AVL9 PE=1 SV=1 12 263 1.0E-40
sp|Q80U56|AVL9_MOUSE Late secretory pathway protein AVL9 homolog OS=Mus musculus GN=Avl9 PE=1 SV=2 11 242 2.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12500|AVL9_YEAST Late secretory pathway protein AVL9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVL9 PE=1 SV=1 22 470 2.0E-117
sp|O13943|AVL9_SCHPO Late secretory pathway protein avl9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avl9 PE=3 SV=2 22 457 1.0E-98
sp|Q5R991|AVL9_PONAB Late secretory pathway protein AVL9 homolog OS=Pongo abelii GN=AVL9 PE=2 SV=1 12 263 1.0E-40
sp|Q8NBF6|AVL9_HUMAN Late secretory pathway protein AVL9 homolog OS=Homo sapiens GN=AVL9 PE=1 SV=1 12 263 1.0E-40
sp|Q80U56|AVL9_MOUSE Late secretory pathway protein AVL9 homolog OS=Mus musculus GN=Avl9 PE=1 SV=2 11 242 2.0E-40
sp|Q8NBF6|AVL9_HUMAN Late secretory pathway protein AVL9 homolog OS=Homo sapiens GN=AVL9 PE=1 SV=1 272 495 2.0E-24
sp|Q80U56|AVL9_MOUSE Late secretory pathway protein AVL9 homolog OS=Mus musculus GN=Avl9 PE=1 SV=2 272 495 2.0E-24
sp|Q5R991|AVL9_PONAB Late secretory pathway protein AVL9 homolog OS=Pongo abelii GN=AVL9 PE=2 SV=1 272 477 7.0E-20
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4461
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4800
Ophiocordyceps australis map64 (Brazil) OphauB2|3568
Ophiocordyceps camponoti-floridani Ophcf2|03938
Ophiocordyceps camponoti-rufipedis Ophun1|6208 (this protein)
Ophiocordyceps kimflemingae Ophio5|4775
Ophiocordyceps subramaniannii Hirsu2|9261

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6208
MSSGDDSSSLDGASSTPFAPLVTVVGFHHARGPEVETWFGVEDGADPCTDFSWSLLPFMALSDGAHASEEDFSYF
TLLRPAADFQPATSLFGISCTRQLDASQLLNRPADVTRSTVQKAVVVIADSPQFFGMLRERLSIVTQAWFAQRDF
TDVEILRRFQESLADEKERGALASDANRDQYLGMSLRELIHEFKWQTLVLFKCCLLQPKMLFFGSRCDRLCMIQF
SLISLIPGLLRSLQDCADPDLDSYEKKLSRPSSLQSSNRSSLLSFMGLPLQIFGKGGFFGPYTPLQQLDILADFG
TKSYLVGSTNSLLLQQRDRYSDILINLDEDTVTITSPSLRSALALTAADRRWIDFITQEVNETWDEANPSRPKTL
QYIGSEEFIRSQFEAYILGLISSVKYHNFLASNADGSKGAEDPAIDFGLDWVEAWERTENYRMWNTHTDANLFAV
SEPKHPCAGGLTMDDVQRRISEQVKELHLDERFAQGREMLGRNLAVGREKASTMLNRLYADVEYLRESQRRRSDE
SKPPDTKSPSEKPQAQYPVDLAKASQTMQSVGVKASAYVSSWASWAGEKRKGGGWGAAWGRKPKTASDPASPVKQ
ATSPRSSRAPSMDDFANNRPPTQASFSESILAKTSGANPPEHH*
Coding >Ophun1|6208
ATGAGCAGCGGCGACGATAGCAGCTCCCTCGACGGGGCTTCGTCGACGCCCTTTGCGCCCCTCGTCACCGTCGTC
GGCTTCCATCATGCCCGTGGCCCCGAGGTCGAGACGTGGTTCGGCGTCGAGGATGGTGCCGATCCCTGCACCGAC
TTCTCCTGGTCTCTGCTGCCCTTCATGGCCCTGAGTGATGGCGCCCACGCATCCGAAGAAGACTTTTCCTACTTT
ACCCTCCTGAGGCCCGCCGCCGACTTCCAGCCCGCCACGTCTCTGTTCGGCATCTCGTGCACTCGACAGCTCGAT
GCGTCTCAGCTCCTCAACCGCCCCGCCGACGTCACGCGTTCAACGGTTCAAAAGGCCGTTGTCGTCATCGCCGAT
AGCCCCCAATTTTTCGGAATGCTGCGCGAGCGCCTGAGCATCGTCACCCAGGCTTGGTTCGCCCAGCGCGACTTT
ACCGACGTCGAAATCCTGCGCCGCTTCCAGGAGAGCCTGGCCGACGAGAAAGAAAGGGGCGCCTTGGCCAGCGAC
GCCAACCGGGATCAGTACCTCGGCATGAGCTTGCGCGAGCTCATCCACGAGTTCAAGTGGCAGACGCTGGTCCTC
TTCAAGTGCTGTCTTCTGCAGCCCAAGATGCTCTTCTTCGGCTCCCGCTGCGATAGGCTGTGCATGATCCAATTC
TCCCTCATCTCCCTGATACCCGGACTCTTGCGCAGCCTGCAGGACTGCGCCGACCCAGACCTCGACAGCTATGAG
AAGAAGCTTTCGCGGCCGTCGAGTCTGCAGAGCAGCAACCGGAGCTCCCTCCTGTCATTTATGGGGCTTCCCCTG
CAGATCTTTGGCAAGGGCGGCTTCTTCGGCCCCTATACGCCGCTGCAGCAACTCGACATCCTGGCCGACTTTGGC
ACCAAGTCGTACCTGGTCGGCAGCACCAACTCACTGCTTCTCCAGCAGAGGGACCGATACAGCGACATCCTCATC
AACCTCGACGAGGACACCGTCACCATCACGTCGCCGTCCCTGAGGTCGGCCCTGGCCCTGACCGCGGCCGACCGT
CGGTGGATCGACTTCATCACCCAAGAGGTCAACGAGACGTGGGACGAGGCGAACCCCAGCAGGCCCAAGACGTTG
CAGTACATTGGGAGCGAGGAGTTTATCCGGTCCCAGTTTGAGGCCTACATCCTCGGCCTGATATCGTCGGTGAAG
TACCACAACTTCTTGGCCTCCAACGCCGACGGCTCCAAGGGCGCCGAGGATCCGGCCATCGATTTCGGACTGGAC
TGGGTCGAGGCCTGGGAGCGTACAGAGAACTATCGCATGTGGAACACGCACACCGACGCCAACCTCTTTGCCGTC
TCAGAGCCCAAGCACCCGTGCGCCGGCGGCCTCACCATGGACGACGTCCAGAGGCGCATCTCGGAACAGGTCAAG
GAGCTACATCTCGACGAACGATTTGCTCAGGGCCGTGAGATGCTGGGCCGCAACCTGGCCGTCGGTCGCGAAAAG
GCATCGACGATGCTCAACAGGCTCTACGCCGACGTCGAGTATCTACGCGAATCCCAACGTCGCCGCTCCGACGAG
TCCAAACCCCCGGACACCAAGTCGCCGTCAGAGAAGCCGCAAGCCCAGTACCCAGTCGACCTCGCCAAGGCATCG
CAAACAATGCAGTCAGTCGGCGTCAAGGCCAGCGCCTACGTCTCCAGCTGGGCCAGCTGGGCAGGCGAGAAGCGC
AAGGGCGGTGGCTGGGGCGCGGCATGGGGTAGGAAGCCCAAGACGGCCTCTGATCCGGCCAGCCCAGTCAAGCAG
GCGACCAGTCCGCGCTCCTCTCGTGCGCCGTCGATGGACGACTTTGCGAATAACAGGCCGCCGACGCAGGCCAGC
TTCAGCGAGAGCATCCTGGCGAAGACATCCGGGGCGAATCCGCCCGAGCATCACTGA
Transcript >Ophun1|6208
ATGAGCAGCGGCGACGATAGCAGCTCCCTCGACGGGGCTTCGTCGACGCCCTTTGCGCCCCTCGTCACCGTCGTC
GGCTTCCATCATGCCCGTGGCCCCGAGGTCGAGACGTGGTTCGGCGTCGAGGATGGTGCCGATCCCTGCACCGAC
TTCTCCTGGTCTCTGCTGCCCTTCATGGCCCTGAGTGATGGCGCCCACGCATCCGAAGAAGACTTTTCCTACTTT
ACCCTCCTGAGGCCCGCCGCCGACTTCCAGCCCGCCACGTCTCTGTTCGGCATCTCGTGCACTCGACAGCTCGAT
GCGTCTCAGCTCCTCAACCGCCCCGCCGACGTCACGCGTTCAACGGTTCAAAAGGCCGTTGTCGTCATCGCCGAT
AGCCCCCAATTTTTCGGAATGCTGCGCGAGCGCCTGAGCATCGTCACCCAGGCTTGGTTCGCCCAGCGCGACTTT
ACCGACGTCGAAATCCTGCGCCGCTTCCAGGAGAGCCTGGCCGACGAGAAAGAAAGGGGCGCCTTGGCCAGCGAC
GCCAACCGGGATCAGTACCTCGGCATGAGCTTGCGCGAGCTCATCCACGAGTTCAAGTGGCAGACGCTGGTCCTC
TTCAAGTGCTGTCTTCTGCAGCCCAAGATGCTCTTCTTCGGCTCCCGCTGCGATAGGCTGTGCATGATCCAATTC
TCCCTCATCTCCCTGATACCCGGACTCTTGCGCAGCCTGCAGGACTGCGCCGACCCAGACCTCGACAGCTATGAG
AAGAAGCTTTCGCGGCCGTCGAGTCTGCAGAGCAGCAACCGGAGCTCCCTCCTGTCATTTATGGGGCTTCCCCTG
CAGATCTTTGGCAAGGGCGGCTTCTTCGGCCCCTATACGCCGCTGCAGCAACTCGACATCCTGGCCGACTTTGGC
ACCAAGTCGTACCTGGTCGGCAGCACCAACTCACTGCTTCTCCAGCAGAGGGACCGATACAGCGACATCCTCATC
AACCTCGACGAGGACACCGTCACCATCACGTCGCCGTCCCTGAGGTCGGCCCTGGCCCTGACCGCGGCCGACCGT
CGGTGGATCGACTTCATCACCCAAGAGGTCAACGAGACGTGGGACGAGGCGAACCCCAGCAGGCCCAAGACGTTG
CAGTACATTGGGAGCGAGGAGTTTATCCGGTCCCAGTTTGAGGCCTACATCCTCGGCCTGATATCGTCGGTGAAG
TACCACAACTTCTTGGCCTCCAACGCCGACGGCTCCAAGGGCGCCGAGGATCCGGCCATCGATTTCGGACTGGAC
TGGGTCGAGGCCTGGGAGCGTACAGAGAACTATCGCATGTGGAACACGCACACCGACGCCAACCTCTTTGCCGTC
TCAGAGCCCAAGCACCCGTGCGCCGGCGGCCTCACCATGGACGACGTCCAGAGGCGCATCTCGGAACAGGTCAAG
GAGCTACATCTCGACGAACGATTTGCTCAGGGCCGTGAGATGCTGGGCCGCAACCTGGCCGTCGGTCGCGAAAAG
GCATCGACGATGCTCAACAGGCTCTACGCCGACGTCGAGTATCTACGCGAATCCCAACGTCGCCGCTCCGACGAG
TCCAAACCCCCGGACACCAAGTCGCCGTCAGAGAAGCCGCAAGCCCAGTACCCAGTCGACCTCGCCAAGGCATCG
CAAACAATGCAGTCAGTCGGCGTCAAGGCCAGCGCCTACGTCTCCAGCTGGGCCAGCTGGGCAGGCGAGAAGCGC
AAGGGCGGTGGCTGGGGCGCGGCATGGGGTAGGAAGCCCAAGACGGCCTCTGATCCGGCCAGCCCAGTCAAGCAG
GCGACCAGTCCGCGCTCCTCTCGTGCGCCGTCGATGGACGACTTTGCGAATAACAGGCCGCCGACGCAGGCCAGC
TTCAGCGAGAGCATCCTGGCGAAGACATCCGGGGCGAATCCGCCCGAGCATCACTGA
Gene >Ophun1|6208
ATGAGCAGCGGCGACGATAGCAGCTCCCTCGACGGGGCTTCGTCGACGCCCTTTGCGCCCCTCGTCACCGTCGTC
GGCTTCCATCATGCCCGTGGCCCCGAGGTCGAGACGTGGTTCGGCGTCGAGGATGGTGCCGATCCCTGCACCGAC
TTCTCCTGGTCTCTGCTGCCCTTCATGGCCCTGAGTGATGGCGCCCACGCGTCAGTCGACCATCCGCGGCAATGG
CTGCTGGACGCGCTGACAGCCCCAGATCCGAAGAAGACTTTTCCTACTTTACCCTCCTGAGGCCCGCCGCCGACT
TCCAGCCCGCCACGTCTCTGTTCGGCATCTCGTGCACTCGACAGCTCGATGCGTCTCAGCTCCTCAACCGCCCCG
CCGACGTCACGCGTTCAACGGTTCAAAAGGCCGTTGTCGTCATCGCCGATAGCCCCCAATTTTTCGGAATGCTGC
GCGAGCGCCTGAGCATCGTCACCCAGGCTTGGTTCGCCCAGCGCGACTTTACCGACGTCGAAATCCTGCGCCGCT
TCCAGGAGAGCCTGGCCGACGAGAAAGAAAGGGGCGCCTTGGCCAGCGACGCCAACCGGGATCAGTACCTCGGCA
TGAGCTTGCGCGAGCTCATCCACGAGTTCAAGTGGCAGACGCTGGTCCTCTTCAAGTGCTGTCTTCTGCAGCCCA
AGGTGCGTCAATTCCTTTGTCCACCACCACGCGCGCAGGCCGAAGCTCATTCGTATGTAGATGCTCTTCTTCGGC
TCCCGCTGCGATAGGCTGTGCATGATCCAATTCTCCCTCATCTCCCTGATACCCGGACTCTTGCGCAGCCTGCAG
GACTGCGCCGACCCAGACCTCGACAGCTATGAGAAGAAGCTTTCGCGGCCGTCGAGTCTGCAGAGCAGCAACCGG
AGCTCCCTCCTGTCATTTATGGGGCTTCCCCTGCAGATCTTTGGCAAGGTTCGATAGGATAGCTCGATTCTCTTT
GTGATGGCGCCGCTGATTCGTGTCTGAACGCAGGGCGGCTTCTTCGGCCCCTATACGCCGCTGCAGCAACTCGAC
ATCCTGGCCGACTTTGGCACCAAGTCGTACCTGGTCGGCAGCACCAACTCACTGCTTCTCCAGCAGAGGGACCGA
TACAGCGACATCCTCATCAACCTCGACGAGGACACCGTCACCATCACGTCGCCGTCCCTGAGGTCGGCCCTGGCC
CTGACCGCGGCCGACCGTCGGTGGATCGACTTCATCACCCAAGAGGTCAACGAGACGTGGGACGAGGCGAACCCC
AGCAGGCCCAAGACGTTGCAGTACATTGGGAGCGAGGAGTTTATCCGGTCCCAGTTTGAGGCCTACATCCTCGGC
CTGATATCGTCGGTGAAGTACCACAACTTCTTGGCCTCCAACGCCGACGGCTCCAAGGGCGCCGAGGATCCGGCC
ATCGATTTCGGACTGGACTGGGTCGAGGCCTGGGAGCGTACAGAGAACTATCGCATGTGGAACACGCACACCGAC
GCCAACCTCTTTGCCGTCTCAGAGCCCAAGCACCCGTGCGCCGGCGGCCTCACCATGGACGACGTCCAGAGGCGC
ATCTCGGAACAGGTCAAGGAGCTACATCTCGACGAACGATTTGCTCAGGGCCGTGAGATGCTGGGCCGCAACCTG
GCCGTCGGTCGCGAAAAGGCATCGACGATGCTCAACAGGCTCTACGCCGACGTCGAGTATCTACGCGAATCCCAA
CGTCGCCGCTCCGACGAGTCCAAACCCCCGGACACCAAGTCGCCGTCAGAGAAGCCGCAAGCCCAGTACCCAGTC
GACCTCGCCAAGGCATCGCAAACAATGCAGTCAGTCGGCGTCAAGGCCAGCGCCTACGTCTCCAGCTGGGCCAGC
TGGGCAGGCGAGAAGCGCAAGGGCGGTGGCTGGGGCGCGGCATGGGGTAGGAAGCCCAAGACGGCCTCTGATCCG
GCCAGCCCAGTCAAGCAGGCGACCAGTCCGCGCTCCTCTCGTGCGCCGTCGATGGACGACTTTGCGAATAACAGG
CCGCCGACGCAGGCCAGCTTCAGCGAGAGCATCCTGTCCGGCGCCAGCGGCTCCCACGATGGAAGGCCCCTCTCC
AAGTCCTCTGCCGCCGACATGTCCAGCATCCAGGGCGAAGACATCCGGGGCGAATCCGCCCGAGCATCACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail