Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6205
Gene name
LocationContig_660:4972..9313
Strand-
Gene length (bp)4341
Transcript length (bp)3363
Coding sequence length (bp)3363
Protein length (aa) 1121

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00199 Catalase Catalase 3.5E-167 41 427
PF03462 PCRF PCRF domain 5.8E-41 759 936
PF00472 RF-1 RF-1 domain 2.7E-33 959 1068
PF06628 Catalase-rel Catalase-related immune-responsive 3.9E-17 455 518
PF18011 Catalase_C C-terminal domain found in long catalases 2.5E-11 552 699
PF01965 DJ-1_PfpI DJ-1/PfpI family 2.8E-10 553 663

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C168|CAT1_NEUCR Catalase-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cat-1 PE=1 SV=2 26 721 0.0E+00
sp|P78574|CATA_ASPFU Catalase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=catA PE=3 SV=2 13 722 0.0E+00
sp|P55305|CATA_EMENI Catalase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=catA PE=2 SV=2 7 722 0.0E+00
sp|P30266|CATE_BACPE Catalase OS=Bacillus pseudofirmus (strain OF4) GN=katE PE=3 SV=3 38 685 0.0E+00
sp|Q9I1W8|CATE_PSEAE Catalase HPII OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=katE PE=3 SV=1 32 659 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C168|CAT1_NEUCR Catalase-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cat-1 PE=1 SV=2 26 721 0.0E+00
sp|P78574|CATA_ASPFU Catalase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=catA PE=3 SV=2 13 722 0.0E+00
sp|P55305|CATA_EMENI Catalase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=catA PE=2 SV=2 7 722 0.0E+00
sp|P30266|CATE_BACPE Catalase OS=Bacillus pseudofirmus (strain OF4) GN=katE PE=3 SV=3 38 685 0.0E+00
sp|Q9I1W8|CATE_PSEAE Catalase HPII OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=katE PE=3 SV=1 32 659 0.0E+00
sp|P95539|CATE_PSEPU Catalase HPII OS=Pseudomonas putida GN=katE PE=3 SV=1 39 683 0.0E+00
sp|P50979|CATE_MYCAV Catalase HPII OS=Mycobacterium avium GN=katE PE=3 SV=1 39 689 0.0E+00
sp|P42234|CATE_BACSU Catalase-2 OS=Bacillus subtilis (strain 168) GN=katE PE=3 SV=2 34 721 0.0E+00
sp|Q55DH8|CATB_DICDI Catalase-B OS=Dictyostelium discoideum GN=catB PE=1 SV=1 63 732 0.0E+00
sp|P21179|CATE_ECOLI Catalase HPII OS=Escherichia coli (strain K12) GN=katE PE=1 SV=1 1 701 0.0E+00
sp|Q9X576|CATE_RHIME Catalase C OS=Rhizobium meliloti (strain 1021) GN=katE PE=2 SV=2 63 663 4.0E-180
sp|Q9Y7C2|CATB_AJECA Catalase B OS=Ajellomyces capsulatus GN=CATB PE=2 SV=1 63 711 6.0E-146
sp|Q8X1P0|CATA_BLUGH Catalase OS=Blumeria graminis f. sp. hordei GN=CAT1 PE=3 SV=1 1 661 4.0E-144
sp|Q9C169|CAT3_NEUCR Catalase-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cat-3 PE=1 SV=1 39 665 1.0E-143
sp|Q877A8|CATB_ASPOR Catalase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=catB PE=2 SV=1 63 663 5.0E-141
sp|P78619|CATB_EMENI Catalase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=catB PE=2 SV=2 63 711 3.0E-140
sp|Q92405|CATB_ASPFU Catalase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=catB PE=1 SV=1 58 711 4.0E-139
sp|P55303|CATR_ASPNG Catalase R OS=Aspergillus niger GN=catR PE=3 SV=1 39 663 1.0E-136
sp|P0A323|CATA_BORPE Catalase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=katA PE=1 SV=1 63 426 7.0E-115
sp|P0A325|CATA_BORPA Catalase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=katA PE=3 SV=1 63 426 7.0E-115
sp|P0A324|CATA_BORBR Catalase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=katA PE=3 SV=1 63 426 7.0E-115
sp|P77872|CATA_HELPY Catalase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=katA PE=1 SV=2 63 515 1.0E-113
sp|Q43206|CATA1_WHEAT Catalase-1 OS=Triticum aestivum GN=CAT1 PE=2 SV=1 49 522 2.0E-113
sp|Q0D9C4|CATA2_ORYSJ Catalase isozyme B OS=Oryza sativa subsp. japonica GN=CATB PE=2 SV=1 63 472 2.0E-112
sp|A2YH64|CATA2_ORYSI Catalase isozyme B OS=Oryza sativa subsp. indica GN=CATB PE=2 SV=2 63 472 2.0E-112
sp|Q59714|CATA_PSEPU Catalase OS=Pseudomonas putida GN=katA PE=3 SV=1 63 523 4.0E-112
sp|Q9ZKX5|CATA_HELPJ Catalase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=katA PE=3 SV=1 63 515 5.0E-112
sp|P26901|CATA_BACSU Vegetative catalase OS=Bacillus subtilis (strain 168) GN=katA PE=1 SV=5 35 516 2.0E-111
sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 40 429 4.0E-111
sp|P33569|BCA_STRVP Bromoperoxidase-catalase OS=Streptomyces venezuelae (strain ATCC 10712 / CBS 650.69 / DSM 40230 / JCM 4526 / NBRC 13096 / PD 04745) GN=bca PE=1 SV=1 63 509 8.0E-111
sp|P17598|CATA1_GOSHI Catalase isozyme 1 OS=Gossypium hirsutum GN=CAT1 PE=2 SV=2 39 457 2.0E-110
sp|P45739|CATA_HELAN Catalase OS=Helianthus annuus PE=2 SV=1 40 473 3.0E-110
sp|Q27710|CATA_ONCVE Catalase OS=Onchocerca volvulus endobacterium GN=cat PE=2 SV=1 63 478 6.0E-110
sp|P45737|CATA_BACFR Catalase OS=Bacteroides fragilis (strain YCH46) GN=katA PE=1 SV=1 63 458 2.0E-109
sp|Q96528|CATA1_ARATH Catalase-1 OS=Arabidopsis thaliana GN=CAT1 PE=2 SV=3 39 460 2.0E-109
sp|P25819|CATA2_ARATH Catalase-2 OS=Arabidopsis thaliana GN=CAT2 PE=2 SV=3 63 460 3.0E-109
sp|P55307|CATA1_HORVU Catalase isozyme 1 OS=Hordeum vulgare GN=CAT1 PE=2 SV=1 40 460 3.0E-109
sp|P29756|CATA1_SOYBN Catalase-1/2 OS=Glycine max GN=CAT1 PE=2 SV=1 40 457 4.0E-109
sp|O93662|CATA_METBF Catalase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=kat PE=3 SV=1 32 480 8.0E-109
sp|P18122|CATA1_MAIZE Catalase isozyme 1 OS=Zea mays GN=CAT1 PE=2 SV=1 61 460 1.0E-108
sp|O48560|CATA3_SOYBN Catalase-3 OS=Glycine max GN=CAT3 PE=2 SV=1 40 457 3.0E-108
sp|P25890|CATA_PEA Catalase OS=Pisum sativum PE=2 SV=1 40 429 4.0E-108
sp|O48561|CATA4_SOYBN Catalase-4 OS=Glycine max GN=CAT4 PE=2 SV=1 40 457 7.0E-108
sp|O68146|CATA_VIBF1 Catalase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=katA PE=2 SV=1 56 424 8.0E-108
sp|P42321|CATA_PROMI Catalase OS=Proteus mirabilis GN=katA PE=1 SV=1 63 488 9.0E-108
sp|Q01297|CATA1_RICCO Catalase isozyme 1 OS=Ricinus communis GN=CAT1 PE=2 SV=2 40 457 1.0E-107
sp|P49315|CATA1_NICPL Catalase isozyme 1 (Fragment) OS=Nicotiana plumbaginifolia GN=CAT1 PE=2 SV=1 39 429 3.0E-107
sp|P55308|CATA2_HORVU Catalase isozyme 2 OS=Hordeum vulgare GN=CAT2 PE=2 SV=1 63 523 5.0E-107
sp|P30567|CATA2_GOSHI Catalase isozyme 2 OS=Gossypium hirsutum GN=CAT2 PE=2 SV=1 40 429 5.0E-107
sp|P55313|CATA2_WHEAT Catalase OS=Triticum aestivum GN=CATA PE=2 SV=1 40 460 9.0E-107
sp|P49317|CATA3_NICPL Catalase isozyme 3 OS=Nicotiana plumbaginifolia GN=CAT3 PE=2 SV=1 63 457 1.0E-106
sp|P32290|CATA_VIGRR Catalase OS=Vigna radiata var. radiata PE=2 SV=1 40 457 2.0E-106
sp|Q0E4K1|CATA1_ORYSJ Catalase isozyme A OS=Oryza sativa subsp. japonica GN=CATA PE=2 SV=1 38 522 2.0E-106
sp|P0C549|CATA1_ORYSI Catalase isozyme A OS=Oryza sativa subsp. indica PE=2 SV=1 38 522 2.0E-106
sp|Q9Z598|CATA_STRCO Catalase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=katA PE=3 SV=1 63 519 4.0E-106
sp|P48351|CATA2_CUCPE Catalase isozyme 2 OS=Cucurbita pepo GN=CAT2 PE=2 SV=1 43 473 4.0E-106
sp|P49318|CATA2_RICCO Catalase isozyme 2 OS=Ricinus communis GN=CAT2 PE=2 SV=1 34 429 5.0E-106
sp|Q9XHH3|CATA2_SOLLC Catalase isozyme 2 OS=Solanum lycopersicum GN=CAT2 PE=2 SV=1 39 429 1.0E-105
sp|P48350|CATA1_CUCPE Catalase isozyme 1 OS=Cucurbita pepo GN=CAT1 PE=2 SV=1 39 460 3.0E-105
sp|Q8D452|CATA_VIBVU Catalase OS=Vibrio vulnificus (strain CMCP6) GN=VV2_1473 PE=3 SV=2 63 522 3.0E-104
sp|Q7MFM6|CATA_VIBVY Catalase OS=Vibrio vulnificus (strain YJ016) GN=VVA0294 PE=3 SV=1 63 522 9.0E-104
sp|P12365|CATA2_MAIZE Catalase isozyme 2 OS=Zea mays GN=CAT2 PE=2 SV=3 40 460 3.0E-103
sp|P04762|CATA_RAT Catalase OS=Rattus norvegicus GN=Cat PE=1 SV=3 52 477 3.0E-103
sp|P55312|CATA2_SOLTU Catalase isozyme 2 OS=Solanum tuberosum GN=CAT2 PE=3 SV=1 63 434 4.0E-103
sp|P48352|CATA3_CUCPE Catalase isozyme 3 OS=Cucurbita pepo GN=CAT3 PE=2 SV=1 43 473 5.0E-103
sp|Q87JE8|CATA_VIBPA Catalase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=VPA0305 PE=3 SV=2 63 500 7.0E-103
sp|P49316|CATA2_NICPL Catalase isozyme 2 OS=Nicotiana plumbaginifolia GN=CAT2 PE=2 SV=1 63 523 8.0E-103
sp|P90682|CATA_ASCSU Catalase OS=Ascaris suum GN=CAT PE=2 SV=2 63 519 1.0E-102
sp|P07145|CATA_IPOBA Catalase OS=Ipomoea batatas PE=2 SV=1 63 427 2.0E-102
sp|P30264|CATA1_SOLLC Catalase isozyme 1 OS=Solanum lycopersicum GN=CAT1 PE=2 SV=1 63 434 2.0E-102
sp|Q59296|CATA_CAMJE Catalase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=katA PE=3 SV=1 38 515 2.0E-102
sp|P55311|CATA_SOLME Catalase OS=Solanum melongena PE=2 SV=1 63 434 2.0E-102
sp|P24168|CATA_LISSE Catalase OS=Listeria seeligeri GN=kat PE=3 SV=1 63 480 2.0E-102
sp|P49319|CATA1_TOBAC Catalase isozyme 1 OS=Nicotiana tabacum GN=CAT-1 PE=1 SV=2 63 523 3.0E-102
sp|Q9AXH0|CATA_AVIMR Catalase OS=Avicennia marina PE=2 SV=1 11 427 3.0E-102
sp|Q9PWF7|CATA_RUGRU Catalase OS=Rugosa rugosa GN=cat PE=2 SV=3 37 468 3.0E-102
sp|Q926X0|CATA_LISIN Catalase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kat PE=3 SV=1 63 480 4.0E-102
sp|Q27487|CATA1_CAEEL Peroxisomal catalase 1 OS=Caenorhabditis elegans GN=ctl-2 PE=2 SV=3 63 426 5.0E-102
sp|Q9KRQ1|CATA_VIBCH Catalase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_1585 PE=3 SV=2 63 509 5.0E-102
sp|O97492|CATA_CANLF Catalase OS=Canis lupus familiaris GN=CAT PE=1 SV=3 52 468 6.0E-102
sp|Q42547|CATA3_ARATH Catalase-3 OS=Arabidopsis thaliana GN=CAT3 PE=1 SV=3 63 429 8.0E-102
sp|P18123|CATA3_MAIZE Catalase isozyme 3 OS=Zea mays GN=CAT3 PE=2 SV=2 63 425 8.0E-102
sp|P44390|CATA_HAEIN Catalase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=katA PE=2 SV=1 63 528 9.0E-102
sp|Q9ZN99|CATA_DESVM Catalase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=katA PE=3 SV=2 63 426 2.0E-101
sp|Q59337|CATA_DEIRA Catalase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=katA PE=1 SV=2 63 522 2.0E-101
sp|Q9M5L6|CATA_CAPAN Catalase OS=Capsicum annuum GN=CAT PE=2 SV=1 63 434 3.0E-101
sp|Q2I6W4|CATA_CALJA Catalase OS=Callithrix jacchus GN=CAT PE=2 SV=3 52 480 3.0E-101
sp|P24270|CATA_MOUSE Catalase OS=Mus musculus GN=Cat PE=1 SV=4 52 477 3.0E-101
sp|P94377|CATX_BACSU Catalase X OS=Bacillus subtilis (strain 168) GN=katX PE=3 SV=1 7 516 4.0E-101
sp|P30265|CATA_LACSK Catalase OS=Lactobacillus sakei GN=katA PE=3 SV=2 61 519 6.0E-101
sp|O61235|CATA2_CAEEL Catalase-2 OS=Caenorhabditis elegans GN=ctl-1 PE=2 SV=3 63 522 7.0E-101
sp|P49284|CATA1_SOLTU Catalase isozyme 1 OS=Solanum tuberosum GN=CAT1 PE=2 SV=1 63 434 1.0E-100
sp|O62839|CATA_PIG Catalase OS=Sus scrofa GN=CAT PE=1 SV=4 52 480 2.0E-100
sp|O52762|CATA_PSEAE Catalase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=katA PE=1 SV=1 63 523 2.0E-100
sp|Q49XC1|CATA_STAS1 Catalase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=katA PE=3 SV=1 34 463 2.0E-100
sp|Q8Y3P9|CATA_LISMO Catalase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=kat PE=3 SV=1 63 430 3.0E-100
sp|Q66V81|CATB_STAXY Catalase B OS=Staphylococcus xylosus GN=katB PE=3 SV=2 34 463 5.0E-100
sp|P04040|CATA_HUMAN Catalase OS=Homo sapiens GN=CAT PE=1 SV=3 52 480 1.0E-99
sp|Q64405|CATA_CAVPO Catalase OS=Cavia porcellus GN=CAT PE=2 SV=4 52 477 2.0E-99
sp|Q5RF10|CATA_PONAB Catalase OS=Pongo abelii GN=CAT PE=2 SV=3 52 480 3.0E-99
sp|P00432|CATA_BOVIN Catalase OS=Bos taurus GN=CAT PE=1 SV=3 63 469 7.0E-99
sp|Q8NWV5|CATA_STAAW Catalase OS=Staphylococcus aureus (strain MW2) GN=katA PE=3 SV=1 38 430 8.0E-99
sp|Q6G9M4|CATA_STAAS Catalase OS=Staphylococcus aureus (strain MSSA476) GN=katA PE=3 SV=1 38 430 8.0E-99
sp|Q7A5T2|CATA_STAAN Catalase OS=Staphylococcus aureus (strain N315) GN=katA PE=1 SV=2 38 430 8.0E-99
sp|Q99UE2|CATA_STAAM Catalase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=katA PE=3 SV=2 38 430 8.0E-99
sp|Q5HG86|CATA_STAAC Catalase OS=Staphylococcus aureus (strain COL) GN=katA PE=3 SV=2 38 430 8.0E-99
sp|Q2YXT2|CATA_STAAB Catalase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=katA PE=3 SV=2 38 430 8.0E-99
sp|Q2FYU7|CATA_STAA8 Catalase OS=Staphylococcus aureus (strain NCTC 8325) GN=katA PE=2 SV=2 38 430 8.0E-99
sp|Q2FH99|CATA_STAA3 Catalase OS=Staphylococcus aureus (strain USA300) GN=katA PE=3 SV=1 38 430 8.0E-99
sp|Q9L4S1|CATA_STAAU Catalase OS=Staphylococcus aureus GN=katA PE=3 SV=1 38 430 8.0E-99
sp|Q9EV50|CATA_STAXY Catalase A OS=Staphylococcus xylosus GN=katA PE=3 SV=1 38 512 9.0E-99
sp|Q2PUJ9|CATA_STAEP Catalase OS=Staphylococcus epidermidis GN=katA PE=3 SV=1 38 518 1.0E-98
sp|P55310|CATA_SECCE Catalase OS=Secale cereale PE=2 SV=1 38 523 2.0E-98
sp|Q8CPD0|CATA_STAES Catalase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=katA PE=3 SV=1 38 430 2.0E-98
sp|Q5HPK8|CATA_STAEQ Catalase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=katA PE=3 SV=1 38 430 2.0E-98
sp|Q9L4S2|CATB_STAAA Catalase-like protein OS=Staphylococcus aureus subsp. anaerobius GN=katB PE=3 SV=1 38 466 4.0E-98
sp|Q6GH72|CATA_STAAR Catalase OS=Staphylococcus aureus (strain MRSA252) GN=katA PE=3 SV=1 38 430 1.0E-97
sp|Q59635|CATB_PSEAE Catalase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=katB PE=3 SV=1 63 525 2.0E-97
sp|P46206|CATB_PSESY Catalase OS=Pseudomonas syringae pv. syringae GN=katB PE=1 SV=2 24 480 2.0E-97
sp|Q4L643|CATA_STAHJ Catalase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=katA PE=3 SV=1 38 424 3.0E-97
sp|Q9PT92|CATA_DANRE Catalase OS=Danio rerio GN=cat PE=2 SV=1 63 536 6.0E-97
sp|Q59602|CATA_NEIGO Catalase OS=Neisseria gonorrhoeae GN=katA PE=3 SV=1 63 477 7.0E-97
sp|P55306|CATA_SCHPO Catalase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta1 PE=1 SV=1 63 431 2.0E-96
sp|P30263|CATA_PICAN Peroxisomal catalase OS=Pichia angusta GN=PXP9 PE=1 SV=1 62 410 3.0E-96
sp|O77229|CATA_DICDI Catalase-A OS=Dictyostelium discoideum GN=catA PE=2 SV=2 63 484 3.0E-96
sp|P17336|CATA_DROME Catalase OS=Drosophila melanogaster GN=Cat PE=1 SV=2 63 428 4.0E-95
sp|Q9XZD5|CATA_TOXGO Peroxisomal catalase OS=Toxoplasma gondii PE=2 SV=1 62 477 4.0E-94
sp|Q9KW19|CATA_STAWA Catalase OS=Staphylococcus warneri GN=katA PE=3 SV=1 38 424 4.0E-94
sp|P0A326|CATA_BRUME Catalase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=katA PE=3 SV=2 63 484 7.0E-94
sp|P0A327|CATA_BRUAB Catalase OS=Brucella abortus biovar 1 (strain 9-941) GN=katA PE=1 SV=2 63 484 7.0E-94
sp|P07820|CATA_CANTR Peroxisomal catalase OS=Candida tropicalis GN=POX9 PE=1 SV=4 61 436 4.0E-93
sp|Q8FWU0|CATA_BRUSU Catalase OS=Brucella suis biovar 1 (strain 1330) GN=katA PE=3 SV=3 63 484 2.0E-92
sp|P95631|CATA_RHIME Catalase A OS=Rhizobium meliloti (strain 1021) GN=katA PE=3 SV=2 63 428 6.0E-92
sp|Q96VB8|CATA_CANBO Peroxisomal catalase OS=Candida boidinii GN=CTA1 PE=3 SV=1 55 410 4.0E-91
sp|O13289|CATA_CANAL Peroxisomal catalase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CTA1 PE=2 SV=4 61 436 5.0E-91
sp|P29422|CATA_MICLU Catalase OS=Micrococcus luteus GN=katA PE=1 SV=2 63 424 4.0E-86
sp|P55304|CATA_BOTFU Catalase A OS=Botryotinia fuckeliana GN=catA PE=2 SV=1 66 434 2.0E-82
sp|P15202|CATA_YEAST Peroxisomal catalase A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTA1 PE=1 SV=1 63 418 3.0E-82
sp|A6ZV70|CATT_YEAS7 Catalase T OS=Saccharomyces cerevisiae (strain YJM789) GN=CTT1 PE=3 SV=2 63 412 1.0E-80
sp|P06115|CATT_YEAST Catalase T OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTT1 PE=1 SV=3 63 421 2.0E-80
sp|P30775|RF1M_YEAST Peptide chain release factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRF1 PE=1 SV=1 727 1096 2.0E-69
sp|Q09691|RF1M_SCHPO Putative peptide chain release factor 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2F7.17 PE=3 SV=1 733 1096 8.0E-67
sp|B8EI32|RF1_METSB Peptide chain release factor 1 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=prfA PE=3 SV=1 766 1092 4.0E-62
sp|P41767|RF1M_KLULA Peptide chain release factor 1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRF1 PE=3 SV=1 729 1113 5.0E-62
sp|Q1GYE8|RF1_METFK Peptide chain release factor 1 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=prfA PE=3 SV=1 729 1082 1.0E-61
sp|C3LPI4|RF1_VIBCM Peptide chain release factor 1 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=prfA PE=3 SV=1 758 1082 4.0E-61
sp|Q9KQ25|RF1_VIBCH Peptide chain release factor 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=prfA PE=3 SV=1 758 1082 4.0E-61
sp|A5F696|RF1_VIBC3 Peptide chain release factor 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=prfA PE=3 SV=1 758 1082 4.0E-61
sp|Q67TD5|RF1_SYMTH Peptide chain release factor 1 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=prfA PE=3 SV=1 760 1092 4.0E-61
sp|Q3SVP7|RF1_NITWN Peptide chain release factor 1 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=prfA PE=3 SV=1 741 1113 6.0E-61
sp|Q2J423|RF1_RHOP2 Peptide chain release factor 1 OS=Rhodopseudomonas palustris (strain HaA2) GN=prfA PE=3 SV=2 765 1087 7.0E-61
sp|Q6LNB4|RF1_PHOPR Peptide chain release factor 1 OS=Photobacterium profundum GN=prfA PE=3 SV=1 758 1082 8.0E-61
sp|C4LBL5|RF1_TOLAT Peptide chain release factor 1 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=prfA PE=3 SV=1 758 1082 9.0E-61
sp|Q7WCE3|RF1_BORPA Peptide chain release factor 1 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=prfA PE=3 SV=1 729 1082 9.0E-61
sp|B6JA06|RF1_OLICO Peptide chain release factor 1 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=prfA PE=3 SV=1 759 1092 2.0E-60
sp|Q87RN4|RF1_VIBPA Peptide chain release factor 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=prfA PE=3 SV=1 758 1082 2.0E-60
sp|Q89XT9|RF1_BRADU Peptide chain release factor 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=prfA PE=3 SV=1 765 1087 2.0E-60
sp|Q7W023|RF1_BORPE Peptide chain release factor 1 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=prfA PE=3 SV=1 729 1082 2.0E-60
sp|Q7WQE9|RF1_BORBR Peptide chain release factor 1 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=prfA PE=3 SV=1 729 1082 2.0E-60
sp|A9IER8|RF1_BORPD Peptide chain release factor 1 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=prfA PE=3 SV=1 788 1082 4.0E-60
sp|A1SV89|RF1_PSYIN Peptide chain release factor 1 OS=Psychromonas ingrahamii (strain 37) GN=prfA PE=3 SV=1 802 1082 4.0E-60
sp|Q13F02|RF1_RHOPS Peptide chain release factor 1 OS=Rhodopseudomonas palustris (strain BisB5) GN=prfA PE=3 SV=1 765 1113 5.0E-60
sp|A7MY68|RF1_VIBCB Peptide chain release factor 1 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=prfA PE=3 SV=1 758 1082 6.0E-60
sp|P81138|CAT1_PENJA Catalase OS=Penicillium janthinellum PE=1 SV=1 63 409 6.0E-60
sp|P96077|RF1_THET8 Peptide chain release factor 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=prfA PE=1 SV=1 760 1082 8.0E-60
sp|Q72HB8|RF1_THET2 Peptide chain release factor 1 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=prfA PE=1 SV=1 760 1082 8.0E-60
sp|A8FYZ0|RF1_SHESH Peptide chain release factor 1 OS=Shewanella sediminis (strain HAW-EB3) GN=prfA PE=3 SV=1 758 1091 1.0E-59
sp|Q7MMY6|RF1_VIBVY Peptide chain release factor 1 OS=Vibrio vulnificus (strain YJ016) GN=prfA PE=3 SV=2 758 1082 1.0E-59
sp|Q8DFF9|RF1_VIBVU Peptide chain release factor 1 OS=Vibrio vulnificus (strain CMCP6) GN=prfA PE=3 SV=2 758 1082 1.0E-59
sp|Q12QR8|RF1_SHEDO Peptide chain release factor 1 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=prfA PE=3 SV=1 758 1082 1.0E-59
sp|B8E003|RF1_DICTD Peptide chain release factor 1 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=prfA PE=3 SV=1 761 1095 3.0E-59
sp|A6Q162|RF1_NITSB Peptide chain release factor 1 OS=Nitratiruptor sp. (strain SB155-2) GN=prfA PE=3 SV=1 777 1091 3.0E-59
sp|B0TI71|RF1_HELMI Peptide chain release factor 1 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=prfA PE=3 SV=1 742 1079 3.0E-59
sp|B8F526|RF1_HAEPS Peptide chain release factor 1 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=prfA PE=3 SV=1 757 1082 3.0E-59
sp|Q1QQY7|RF1_NITHX Peptide chain release factor 1 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=prfA PE=3 SV=1 765 1113 4.0E-59
sp|B3QCF6|RF1_RHOPT Peptide chain release factor 1 OS=Rhodopseudomonas palustris (strain TIE-1) GN=prfA PE=3 SV=1 765 1113 4.0E-59
sp|Q6NC66|RF1_RHOPA Peptide chain release factor 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=prfA PE=3 SV=1 765 1113 4.0E-59
sp|Q07VB3|RF1_RHOP5 Peptide chain release factor 1 OS=Rhodopseudomonas palustris (strain BisA53) GN=prfA PE=3 SV=1 741 1092 4.0E-59
sp|Q03QX7|RF1_LACBA Peptide chain release factor 1 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=prfA PE=3 SV=1 736 1092 1.0E-58
sp|B2IHL7|RF1_BEII9 Peptide chain release factor 1 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=prfA PE=3 SV=1 766 1111 1.0E-58
sp|A8LLU7|RF1_DINSH Peptide chain release factor 1 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=prfA PE=3 SV=1 757 1092 1.0E-58
sp|Q3A928|RF1_CARHZ Peptide chain release factor 1 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=prfA PE=3 SV=1 760 1092 2.0E-58
sp|A0KMZ8|RF1_AERHH Peptide chain release factor 1 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=prfA PE=3 SV=1 729 1082 2.0E-58
sp|P57852|RF1_PASMU Peptide chain release factor 1 OS=Pasteurella multocida (strain Pm70) GN=prfA PE=3 SV=1 758 1082 3.0E-58
sp|Q1WUD6|RF1_LACS1 Peptide chain release factor 1 OS=Lactobacillus salivarius (strain UCC118) GN=prfA PE=3 SV=1 760 1092 3.0E-58
sp|A1URS5|RF1_BARBK Peptide chain release factor 1 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=prfA PE=3 SV=1 760 1082 3.0E-58
sp|B2SFF6|RF1_FRATM Peptide chain release factor 1 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=prfA PE=3 SV=1 773 1091 3.0E-58
sp|A4IWC1|RF1_FRATW Peptide chain release factor 1 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=prfA PE=3 SV=1 773 1091 4.0E-58
sp|Q0BKE8|RF1_FRATO Peptide chain release factor 1 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=prfA PE=3 SV=1 773 1091 4.0E-58
sp|Q2A1Q0|RF1_FRATH Peptide chain release factor 1 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=prfA PE=3 SV=1 773 1091 4.0E-58
sp|A7NE96|RF1_FRATF Peptide chain release factor 1 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=prfA PE=3 SV=1 773 1091 4.0E-58
sp|B3GZJ0|RF1_ACTP7 Peptide chain release factor 1 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=prfA PE=3 SV=1 758 1082 4.0E-58
sp|Q5NIA8|RF1_FRATT Peptide chain release factor 1 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=prfA PE=3 SV=1 795 1091 4.0E-58
sp|Q14JR1|RF1_FRAT1 Peptide chain release factor 1 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=prfA PE=3 SV=1 795 1091 4.0E-58
sp|A3QH30|RF1_SHELP Peptide chain release factor 1 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=prfA PE=3 SV=1 758 1090 4.0E-58
sp|A6H0W3|RF1_FLAPJ Peptide chain release factor 1 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=prfA PE=3 SV=1 796 1082 5.0E-58
sp|B8FEA2|RF1_DESAA Peptide chain release factor 1 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=prfA PE=3 SV=1 765 1082 5.0E-58
sp|B2G676|RF1_LACRJ Peptide chain release factor 1 OS=Lactobacillus reuteri (strain JCM 1112) GN=prfA PE=3 SV=1 736 1092 5.0E-58
sp|B0TX37|RF1_FRAP2 Peptide chain release factor 1 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=prfA PE=3 SV=1 775 1091 5.0E-58
sp|Q3JDR4|RF1_NITOC Peptide chain release factor 1 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=prfA PE=3 SV=1 764 1113 6.0E-58
sp|A0Q844|RF1_FRATN Peptide chain release factor 1 OS=Francisella tularensis subsp. novicida (strain U112) GN=prfA PE=3 SV=1 773 1091 6.0E-58
sp|Q5P7G7|RF1_AROAE Peptide chain release factor 1 OS=Aromatoleum aromaticum (strain EbN1) GN=prfA PE=3 SV=1 780 1113 6.0E-58
sp|P43917|RF1_HAEIN Peptide chain release factor 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=prfA PE=3 SV=2 758 1082 6.0E-58
sp|Q2KZZ3|RF1_BORA1 Peptide chain release factor 1 OS=Bordetella avium (strain 197N) GN=prfA PE=3 SV=2 760 1082 8.0E-58
sp|B3WDK7|RF1_LACCB Peptide chain release factor 1 OS=Lactobacillus casei (strain BL23) GN=prfA PE=3 SV=1 739 1092 8.0E-58
sp|Q03A29|RF1_LACC3 Peptide chain release factor 1 OS=Lactobacillus casei (strain ATCC 334) GN=prfA PE=3 SV=1 739 1092 8.0E-58
sp|B8G7K1|RF1_CHLAD Peptide chain release factor 1 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=prfA PE=3 SV=1 760 1092 1.0E-57
sp|B2UDM7|RF1_RALPJ Peptide chain release factor 1 OS=Ralstonia pickettii (strain 12J) GN=prfA PE=3 SV=1 764 1113 1.0E-57
sp|Q5LQM7|RF1_RUEPO Peptide chain release factor 1 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=prfA PE=3 SV=1 757 1092 2.0E-57
sp|B4RSV6|RF1_ALTMD Peptide chain release factor 1 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=prfA1 PE=3 SV=1 760 1082 2.0E-57
sp|Q8XVD0|RF1_RALSO Peptide chain release factor 1 OS=Ralstonia solanacearum (strain GMI1000) GN=prfA PE=3 SV=1 764 1086 2.0E-57
sp|A5CYC3|RF1_PELTS Peptide chain release factor 1 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=prfA PE=3 SV=1 733 1092 2.0E-57
sp|Q2N5U6|RF1_ERYLH Peptide chain release factor 1 OS=Erythrobacter litoralis (strain HTCC2594) GN=prfA PE=3 SV=1 765 1082 4.0E-57
sp|C0QTI3|RF1_PERMH Peptide chain release factor 1 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=prfA PE=3 SV=1 760 1095 4.0E-57
sp|B7VKH3|RF1_VIBTL Peptide chain release factor 1 OS=Vibrio tasmaniensis (strain LGP32) GN=prfA PE=3 SV=1 758 1082 5.0E-57
sp|B1KDU3|RF1_SHEWM Peptide chain release factor 1 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=prfA PE=3 SV=1 758 1091 6.0E-57
sp|Q5WUB1|RF1_LEGPL Peptide chain release factor 1 OS=Legionella pneumophila (strain Lens) GN=prfA PE=3 SV=1 760 1086 6.0E-57
sp|Q5ZT29|RF1_LEGPH Peptide chain release factor 1 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=prfA PE=3 SV=1 760 1086 6.0E-57
sp|Q5X2V3|RF1_LEGPA Peptide chain release factor 1 OS=Legionella pneumophila (strain Paris) GN=prfA PE=3 SV=1 760 1086 6.0E-57
sp|Q15SQ9|RF1_PSEA6 Peptide chain release factor 1 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=prfA PE=3 SV=1 765 1095 7.0E-57
sp|Q4QKS1|RF1_HAEI8 Peptide chain release factor 1 OS=Haemophilus influenzae (strain 86-028NP) GN=prfA PE=3 SV=2 758 1082 8.0E-57
sp|A5FHI8|RF1_FLAJ1 Peptide chain release factor 1 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=prfA PE=3 SV=1 796 1082 9.0E-57
sp|Q1LIF3|RF1_CUPMC Peptide chain release factor 1 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=prfA PE=3 SV=2 764 1113 1.0E-56
sp|C5BSZ6|RF1_TERTT Peptide chain release factor 1 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=prfA PE=3 SV=1 761 1091 1.0E-56
sp|Q88UT2|RF1_LACPL Peptide chain release factor 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=prfA PE=3 SV=1 736 1092 1.0E-56
sp|Q087I4|RF1_SHEFN Peptide chain release factor 1 OS=Shewanella frigidimarina (strain NCIMB 400) GN=prfA PE=3 SV=1 760 1082 2.0E-56
sp|A4XJN1|RF1_CALS8 Peptide chain release factor 1 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=prfA PE=3 SV=1 733 1092 2.0E-56
sp|B8CQV2|RF1_SHEPW Peptide chain release factor 1 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=prfA PE=3 SV=1 758 1091 3.0E-56
sp|A4SK64|RF1_AERS4 Peptide chain release factor 1 OS=Aeromonas salmonicida (strain A449) GN=prfA PE=3 SV=1 729 1082 3.0E-56
sp|B6J390|RF1_COXB2 Peptide chain release factor 1 OS=Coxiella burnetii (strain CbuG_Q212) GN=prfA PE=3 SV=1 729 1082 3.0E-56
sp|Q6G5T7|RF1_BARHE Peptide chain release factor 1 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=prfA PE=3 SV=1 760 1092 3.0E-56
sp|A5IED7|RF1_LEGPC Peptide chain release factor 1 OS=Legionella pneumophila (strain Corby) GN=prfA PE=3 SV=1 760 1086 4.0E-56
sp|Q8F9S6|RF1_LEPIN Peptide chain release factor 1 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=prfA PE=3 SV=1 795 1095 4.0E-56
sp|Q72W38|RF1_LEPIC Peptide chain release factor 1 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=prfA PE=3 SV=1 795 1095 4.0E-56
sp|Q5L5L4|RF1_CHLAB Peptide chain release factor 1 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=prfA PE=3 SV=1 752 1092 4.0E-56
sp|A5V9C3|RF1_SPHWW Peptide chain release factor 1 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=prfA PE=3 SV=1 735 1082 4.0E-56
sp|A8GNQ4|RF1_RICAH Peptide chain release factor 1 OS=Rickettsia akari (strain Hartford) GN=prfA PE=3 SV=1 740 1113 4.0E-56
sp|B5FBX0|RF1_VIBFM Peptide chain release factor 1 OS=Vibrio fischeri (strain MJ11) GN=prfA PE=3 SV=1 758 1082 5.0E-56
sp|Q5E6T3|RF1_VIBF1 Peptide chain release factor 1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=prfA PE=3 SV=1 758 1082 5.0E-56
sp|B2GAT1|RF1_LACF3 Peptide chain release factor 1 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=prfA PE=3 SV=1 736 1092 5.0E-56
sp|A6TK43|RF1_ALKMQ Peptide chain release factor 1 OS=Alkaliphilus metalliredigens (strain QYMF) GN=prfA PE=3 SV=1 740 1094 6.0E-56
sp|Q65TB1|RF1_MANSM Peptide chain release factor 1 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=prfA PE=3 SV=1 729 1082 6.0E-56
sp|A0KT88|RF1_SHESA Peptide chain release factor 1 OS=Shewanella sp. (strain ANA-3) GN=prfA PE=3 SV=1 758 1090 6.0E-56
sp|Q0HYK8|RF1_SHESR Peptide chain release factor 1 OS=Shewanella sp. (strain MR-7) GN=prfA PE=3 SV=1 758 1090 6.0E-56
sp|Q0HFC8|RF1_SHESM Peptide chain release factor 1 OS=Shewanella sp. (strain MR-4) GN=prfA PE=3 SV=1 758 1090 6.0E-56
sp|A6WSF0|RF1_SHEB8 Peptide chain release factor 1 OS=Shewanella baltica (strain OS185) GN=prfA PE=3 SV=1 758 1082 6.0E-56
sp|Q0BUJ8|RF1_GRABC Peptide chain release factor 1 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=prfA PE=3 SV=1 757 1111 7.0E-56
sp|B0UUE6|RF1_HISS2 Peptide chain release factor 1 OS=Histophilus somni (strain 2336) GN=prfA PE=3 SV=1 758 1082 7.0E-56
sp|B6EHH5|RF1_ALISL Peptide chain release factor 1 OS=Aliivibrio salmonicida (strain LFI1238) GN=prfA PE=3 SV=1 758 1082 7.0E-56
sp|B8I562|RF1_CLOCE Peptide chain release factor 1 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=prfA PE=3 SV=1 761 1092 7.0E-56
sp|Q6G0R0|RF1_BARQU Peptide chain release factor 1 OS=Bartonella quintana (strain Toulouse) GN=prfA PE=3 SV=1 760 1092 8.0E-56
sp|B1M766|RF1_METRJ Peptide chain release factor 1 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=prfA PE=3 SV=1 765 1092 8.0E-56
sp|Q0I3B5|RF1_HAES1 Peptide chain release factor 1 OS=Haemophilus somnus (strain 129Pt) GN=prfA PE=3 SV=1 758 1082 8.0E-56
sp|Q1GPK3|RF1_SPHAL Peptide chain release factor 1 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=prfA PE=3 SV=1 758 1113 8.0E-56
sp|A7ZB10|RF1_CAMC1 Peptide chain release factor 1 OS=Campylobacter concisus (strain 13826) GN=prfA PE=3 SV=1 746 1091 9.0E-56
sp|B0SQV0|RF1_LEPBP Peptide chain release factor 1 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=prfA PE=3 SV=1 819 1092 1.0E-55
sp|B0SH84|RF1_LEPBA Peptide chain release factor 1 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=prfA PE=3 SV=1 819 1092 1.0E-55
sp|A1RNE1|RF1_SHESW Peptide chain release factor 1 OS=Shewanella sp. (strain W3-18-1) GN=prfA PE=3 SV=1 758 1082 1.0E-55
sp|A4Y3J8|RF1_SHEPC Peptide chain release factor 1 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=prfA PE=3 SV=1 758 1082 1.0E-55
sp|Q46WS9|RF1_CUPPJ Peptide chain release factor 1 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=prfA PE=3 SV=1 780 1082 1.0E-55
sp|Q57B22|RF1_BRUAB Peptide chain release factor 1 OS=Brucella abortus biovar 1 (strain 9-941) GN=prfA PE=3 SV=1 741 1092 1.0E-55
sp|Q2YLN8|RF1_BRUA2 Peptide chain release factor 1 OS=Brucella abortus (strain 2308) GN=prfA PE=3 SV=1 741 1092 1.0E-55
sp|B2S825|RF1_BRUA1 Peptide chain release factor 1 OS=Brucella abortus (strain S19) GN=prfA PE=3 SV=1 741 1092 1.0E-55
sp|B0CIC3|RF1_BRUSI Peptide chain release factor 1 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=prfA PE=3 SV=1 741 1092 1.0E-55
sp|Q8YJ95|RF1_BRUME Peptide chain release factor 1 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=prfA PE=3 SV=2 741 1092 1.0E-55
sp|C0RFB5|RF1_BRUMB Peptide chain release factor 1 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=prfA PE=3 SV=1 741 1092 1.0E-55
sp|Q8EAR3|RF1_SHEON Peptide chain release factor 1 OS=Shewanella oneidensis (strain MR-1) GN=prfA PE=3 SV=1 758 1090 1.0E-55
sp|Q255B5|RF1_CHLFF Peptide chain release factor 1 OS=Chlamydophila felis (strain Fe/C-56) GN=prfA PE=3 SV=1 795 1092 1.0E-55
sp|Q9AG29|RF1_STRAG Peptide chain release factor 1 OS=Streptococcus agalactiae GN=prfA PE=3 SV=1 740 1092 1.0E-55
sp|A9L2D4|RF1_SHEB9 Peptide chain release factor 1 OS=Shewanella baltica (strain OS195) GN=prfA PE=3 SV=1 758 1082 2.0E-55
sp|B5YDB2|RF1_DICT6 Peptide chain release factor 1 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=prfA PE=3 SV=1 743 1098 2.0E-55
sp|Q8FYK3|RF1_BRUSU Peptide chain release factor 1 OS=Brucella suis biovar 1 (strain 1330) GN=prfA PE=3 SV=1 741 1092 2.0E-55
sp|A9M8K5|RF1_BRUC2 Peptide chain release factor 1 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=prfA PE=3 SV=1 741 1092 2.0E-55
sp|A3D0G1|RF1_SHEB5 Peptide chain release factor 1 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=prfA PE=3 SV=1 758 1082 2.0E-55
sp|B8E815|RF1_SHEB2 Peptide chain release factor 1 OS=Shewanella baltica (strain OS223) GN=prfA PE=3 SV=1 758 1082 2.0E-55
sp|A1K443|RF1_AZOSB Peptide chain release factor 1 OS=Azoarcus sp. (strain BH72) GN=prfA PE=3 SV=1 788 1092 2.0E-55
sp|Q9ZD21|RF1_RICPR Peptide chain release factor 1 OS=Rickettsia prowazekii (strain Madrid E) GN=prfA PE=3 SV=1 740 1092 2.0E-55
sp|B9L5Z9|RF1_NAUPA Peptide chain release factor 1 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=prfA PE=3 SV=1 821 1083 2.0E-55
sp|B5ZRR4|RF1_RHILW Peptide chain release factor 1 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=prfA PE=3 SV=1 765 1113 3.0E-55
sp|Q3A129|RF1_PELCD Peptide chain release factor 1 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=prfA PE=3 SV=1 758 1082 3.0E-55
sp|Q831F6|RF1_ENTFA Peptide chain release factor 1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=prfA PE=3 SV=1 746 1092 3.0E-55
sp|P47849|RF1_COXBU Peptide chain release factor 1 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=prfA PE=3 SV=2 729 1082 3.0E-55
sp|A9N9K2|RF1_COXBR Peptide chain release factor 1 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=prfA PE=3 SV=1 729 1082 3.0E-55
sp|A9KGY3|RF1_COXBN Peptide chain release factor 1 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=prfA PE=3 SV=1 729 1082 3.0E-55
sp|B6J625|RF1_COXB1 Peptide chain release factor 1 OS=Coxiella burnetii (strain CbuK_Q154) GN=prfA PE=3 SV=1 729 1082 3.0E-55
sp|Q2GBN7|RF1_NOVAD Peptide chain release factor 1 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=prfA PE=3 SV=1 764 1082 3.0E-55
sp|Q47Y94|RF1_COLP3 Peptide chain release factor 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=prfA PE=3 SV=1 758 1091 3.0E-55
sp|B5XLI8|RF1_STRPZ Peptide chain release factor 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=prfA PE=3 SV=1 746 1092 3.0E-55
sp|Q48TL0|RF1_STRPM Peptide chain release factor 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=prfA PE=3 SV=1 746 1092 3.0E-55
sp|Q99ZP5|RF1_STRP1 Peptide chain release factor 1 OS=Streptococcus pyogenes serotype M1 GN=prfA PE=3 SV=2 746 1092 3.0E-55
sp|Q822M2|RF1_CHLCV Peptide chain release factor 1 OS=Chlamydophila caviae (strain GPIC) GN=prfA PE=3 SV=1 787 1082 3.0E-55
sp|Q2K3T1|RF1_RHIEC Peptide chain release factor 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=prfA PE=3 SV=2 765 1113 4.0E-55
sp|Q4URB6|RF1_XANC8 Peptide chain release factor 1 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=prfA PE=3 SV=1 765 1082 4.0E-55
sp|A9BP60|RF1_DELAS Peptide chain release factor 1 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=prfA PE=3 SV=1 788 1103 4.0E-55
sp|A8GSC7|RF1_RICRS Peptide chain release factor 1 OS=Rickettsia rickettsii (strain Sheila Smith) GN=prfA PE=3 SV=1 760 1105 5.0E-55
sp|B0BXT9|RF1_RICRO Peptide chain release factor 1 OS=Rickettsia rickettsii (strain Iowa) GN=prfA PE=3 SV=1 760 1105 5.0E-55
sp|P0DD95|RF1_STRPQ Peptide chain release factor 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=prfA PE=3 SV=1 746 1092 5.0E-55
sp|P0DD94|RF1_STRP3 Peptide chain release factor 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=prfA PE=3 SV=1 746 1092 5.0E-55
sp|B1MVN7|RF1_LEUCK Peptide chain release factor 1 OS=Leuconostoc citreum (strain KM20) GN=prfA PE=3 SV=1 740 1087 6.0E-55
sp|Q8KG45|RF1_CHLTE Peptide chain release factor 1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=prfA PE=3 SV=1 736 1094 7.0E-55
sp|Q3SG10|RF1_THIDA Peptide chain release factor 1 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=prfA PE=3 SV=1 790 1087 7.0E-55
sp|A3DIL4|RF1_CLOTH Peptide chain release factor 1 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=prfA PE=3 SV=1 761 1074 8.0E-55
sp|Q9Z968|RF1_CHLPN Peptide chain release factor 1 OS=Chlamydia pneumoniae GN=prfA PE=3 SV=1 788 1082 8.0E-55
sp|Q8PC68|RF1_XANCP Peptide chain release factor 1 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=prfA PE=3 SV=1 765 1082 9.0E-55
sp|B0RUA5|RF1_XANCB Peptide chain release factor 1 OS=Xanthomonas campestris pv. campestris (strain B100) GN=prfA PE=3 SV=1 765 1082 9.0E-55
sp|A8ZTL8|RF1_DESOH Peptide chain release factor 1 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=prfA PE=3 SV=1 758 1082 1.0E-54
sp|A4WRK0|RF1_RHOS5 Peptide chain release factor 1 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=prfA PE=3 SV=1 764 1082 1.0E-54
sp|A1VAK8|RF1_DESVV Peptide chain release factor 1 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=prfA PE=3 SV=1 761 1082 1.0E-54
sp|Q727E1|RF1_DESVH Peptide chain release factor 1 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=prfA PE=3 SV=1 761 1082 1.0E-54
sp|Q5XC69|RF1_STRP6 Peptide chain release factor 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=prfA PE=3 SV=1 746 1082 1.0E-54
sp|B3QRH7|RF1_CHLP8 Peptide chain release factor 1 OS=Chlorobaculum parvum (strain NCIB 8327) GN=prfA PE=3 SV=1 736 1094 1.0E-54
sp|Q11E04|RF1_CHESB Peptide chain release factor 1 OS=Chelativorans sp. (strain BNC1) GN=prfA PE=3 SV=1 765 1092 2.0E-54
sp|A8H7A5|RF1_SHEPA Peptide chain release factor 1 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=prfA PE=3 SV=1 758 1091 2.0E-54
sp|B9MR68|RF1_CALBD Peptide chain release factor 1 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=prfA PE=3 SV=1 733 1092 2.0E-54
sp|A6WXQ3|RF1_OCHA4 Peptide chain release factor 1 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=prfA PE=3 SV=1 765 1092 2.0E-54
sp|Q4ULG0|RF1_RICFE Peptide chain release factor 1 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=prfA PE=3 SV=1 740 1106 2.0E-54
sp|A8GXI1|RF1_RICB8 Peptide chain release factor 1 OS=Rickettsia bellii (strain OSU 85-389) GN=prfA PE=3 SV=1 744 1092 3.0E-54
sp|Q92MK5|RF1_RHIME Peptide chain release factor 1 OS=Rhizobium meliloti (strain 1021) GN=prfA PE=3 SV=1 765 1092 3.0E-54
sp|B9LJ02|RF1_CHLSY Peptide chain release factor 1 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=prfA PE=3 SV=1 742 1092 3.0E-54
sp|A9WE79|RF1_CHLAA Peptide chain release factor 1 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=prfA PE=3 SV=1 742 1092 3.0E-54
sp|Q1RJT5|RF1_RICBR Peptide chain release factor 1 OS=Rickettsia bellii (strain RML369-C) GN=prfA PE=3 SV=1 743 1092 3.0E-54
sp|Q3ZYA9|RF1_DEHMC Peptide chain release factor 1 OS=Dehalococcoides mccartyi (strain CBDB1) GN=prfA PE=3 SV=1 737 1092 3.0E-54
sp|A5FQC5|RF1_DEHMB Peptide chain release factor 1 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=prfA PE=3 SV=1 737 1092 3.0E-54
sp|Q0AC04|RF1_ALKEH Peptide chain release factor 1 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=prfA PE=3 SV=1 757 1094 3.0E-54
sp|B3QYI4|RF1_CHLT3 Peptide chain release factor 1 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=prfA PE=3 SV=1 738 1094 3.0E-54
sp|A9IMM3|RF1_BART1 Peptide chain release factor 1 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=prfA PE=3 SV=1 760 1092 3.0E-54
sp|Q492V8|RF1_BLOPB Peptide chain release factor 1 OS=Blochmannia pennsylvanicus (strain BPEN) GN=prfA PE=3 SV=1 760 1082 4.0E-54
sp|A6SUF6|RF1_JANMA Peptide chain release factor 1 OS=Janthinobacterium sp. (strain Marseille) GN=prfA PE=3 SV=1 776 1085 4.0E-54
sp|Q82TH4|RF1_NITEU Peptide chain release factor 1 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=prfA PE=3 SV=1 760 1113 4.0E-54
sp|A2REH9|RF1_STRPG Peptide chain release factor 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=prfA PE=3 SV=1 746 1092 4.0E-54
sp|Q1J6M1|RF1_STRPF Peptide chain release factor 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=prfA PE=3 SV=1 746 1092 4.0E-54
sp|Q1JGV2|RF1_STRPD Peptide chain release factor 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=prfA PE=3 SV=1 746 1092 4.0E-54
sp|Q1JLQ2|RF1_STRPC Peptide chain release factor 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=prfA PE=3 SV=1 746 1092 4.0E-54
sp|Q1JBR9|RF1_STRPB Peptide chain release factor 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=prfA PE=3 SV=1 746 1092 4.0E-54
sp|Q7VMV9|RF1_HAEDU Peptide chain release factor 1 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=prfA PE=3 SV=1 758 1082 4.0E-54
sp|A7GW12|RF1_CAMC5 Peptide chain release factor 1 OS=Campylobacter curvus (strain 525.92) GN=prfA PE=3 SV=1 794 1091 4.0E-54
sp|A0LDT7|RF1_MAGMM Peptide chain release factor 1 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=prfA PE=3 SV=1 757 1083 4.0E-54
sp|B0TR27|RF1_SHEHH Peptide chain release factor 1 OS=Shewanella halifaxensis (strain HAW-EB4) GN=prfA PE=3 SV=1 758 1091 4.0E-54
sp|Q3K119|RF1_STRA1 Peptide chain release factor 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=prfA PE=3 SV=1 746 1092 4.0E-54
sp|Q98G93|RF1_RHILO Peptide chain release factor 1 OS=Rhizobium loti (strain MAFF303099) GN=prfA PE=3 SV=1 760 1092 5.0E-54
sp|B2JHK8|RF1_BURP8 Peptide chain release factor 1 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=prfA PE=3 SV=1 764 1092 5.0E-54
sp|A1B0G1|RF1_PARDP Peptide chain release factor 1 OS=Paracoccus denitrificans (strain Pd 1222) GN=prfA PE=3 SV=1 757 1087 6.0E-54
sp|Q8E5C3|RF1_STRA3 Peptide chain release factor 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=prfA PE=3 SV=1 746 1092 6.0E-54
sp|B3ES89|RF1_AMOA5 Peptide chain release factor 1 OS=Amoebophilus asiaticus (strain 5a2) GN=prfA PE=3 SV=1 740 1083 7.0E-54
sp|A8MJX9|RF1_ALKOO Peptide chain release factor 1 OS=Alkaliphilus oremlandii (strain OhILAs) GN=prfA PE=3 SV=1 740 1082 7.0E-54
sp|Q8DZM4|RF1_STRA5 Peptide chain release factor 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=prfA PE=3 SV=1 746 1092 7.0E-54
sp|Q21YY9|RF1_RHOFT Peptide chain release factor 1 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=prfA PE=3 SV=1 746 1092 7.0E-54
sp|A6Q6B4|RF1_SULNB Peptide chain release factor 1 OS=Sulfurovum sp. (strain NBC37-1) GN=prfA PE=3 SV=1 742 1083 8.0E-54
sp|C0Z828|RF1_BREBN Peptide chain release factor 1 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=prfA PE=3 SV=1 746 1090 8.0E-54
sp|Q3J2B6|RF1_RHOS4 Peptide chain release factor 1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=prfA PE=3 SV=1 764 1082 9.0E-54
sp|Q1MBB2|RF1_RHIL3 Peptide chain release factor 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=prfA PE=3 SV=1 765 1113 1.0E-53
sp|Q9PL16|RF1_CHLMU Peptide chain release factor 1 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=prfA PE=3 SV=1 795 1082 1.0E-53
sp|Q03L79|RF1_STRTD Peptide chain release factor 1 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=prfA PE=3 SV=1 746 1092 1.0E-53
sp|Q5M4W4|RF1_STRT2 Peptide chain release factor 1 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=prfA PE=3 SV=1 746 1092 1.0E-53
sp|Q5M0B7|RF1_STRT1 Peptide chain release factor 1 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=prfA PE=3 SV=1 746 1092 1.0E-53
sp|A3PJZ6|RF1_RHOS1 Peptide chain release factor 1 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=prfA PE=3 SV=1 764 1082 1.0E-53
sp|Q8U8B8|RF1_AGRFC Peptide chain release factor 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=prfA PE=3 SV=1 765 1116 1.0E-53
sp|Q7MXT5|RF1_PORGI Peptide chain release factor 1 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=prfA PE=3 SV=1 746 1093 1.0E-53
sp|A0LYL5|RF1_GRAFK Peptide chain release factor 1 OS=Gramella forsetii (strain KT0803) GN=prfA PE=3 SV=1 761 1082 1.0E-53
sp|Q8P125|RF1_STRP8 Peptide chain release factor 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=prfA PE=3 SV=1 746 1092 1.0E-53
sp|B9KST8|RF1_RHOSK Peptide chain release factor 1 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=prfA PE=3 SV=1 764 1082 2.0E-53
sp|Q3AUE2|RF1_CHLCH Peptide chain release factor 1 OS=Chlorobium chlorochromatii (strain CaD3) GN=prfA PE=3 SV=1 733 1092 2.0E-53
sp|B9JT13|RF1_AGRVS Peptide chain release factor 1 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=prfA PE=3 SV=1 765 1092 2.0E-53
sp|B4E6U6|RF1_BURCJ Peptide chain release factor 1 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=prfA PE=3 SV=1 764 1082 2.0E-53
sp|A8F1S1|RF1_RICM5 Peptide chain release factor 1 OS=Rickettsia massiliae (strain Mtu5) GN=prfA PE=3 SV=1 740 1105 2.0E-53
sp|Q2RFW0|RF1_MOOTA Peptide chain release factor 1 OS=Moorella thermoacetica (strain ATCC 39073) GN=prfA PE=3 SV=1 758 1092 2.0E-53
sp|Q2SL95|RF1_HAHCH Peptide chain release factor 1 OS=Hahella chejuensis (strain KCTC 2396) GN=prfA PE=3 SV=1 760 1091 2.0E-53
sp|C3PNN0|RF1_RICAE Peptide chain release factor 1 OS=Rickettsia africae (strain ESF-5) GN=prfA PE=3 SV=1 760 1105 3.0E-53
sp|Q1GI42|RF1_RUEST Peptide chain release factor 1 OS=Ruegeria sp. (strain TM1040) GN=prfA PE=3 SV=1 757 1092 3.0E-53
sp|C3KYH5|RF1_CLOB6 Peptide chain release factor 1 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=prfA PE=3 SV=1 760 1092 4.0E-53
sp|C4K0C9|RF1_RICPU Peptide chain release factor 1 OS=Rickettsia peacockii (strain Rustic) GN=prfA PE=3 SV=1 760 1105 4.0E-53
sp|A4WBC6|RF1_ENT38 Peptide chain release factor 1 OS=Enterobacter sp. (strain 638) GN=prfA PE=3 SV=1 758 1091 4.0E-53
sp|B1I069|RF1_LYSSC Peptide chain release factor 1 OS=Lysinibacillus sphaericus (strain C3-41) GN=prfA PE=3 SV=1 760 1092 5.0E-53
sp|A0K437|RF1_BURCH Peptide chain release factor 1 OS=Burkholderia cenocepacia (strain HI2424) GN=prfA PE=3 SV=1 764 1082 5.0E-53
sp|B1JUS4|RF1_BURCC Peptide chain release factor 1 OS=Burkholderia cenocepacia (strain MC0-3) GN=prfA PE=3 SV=1 764 1082 5.0E-53
sp|Q1BSB1|RF1_BURCA Peptide chain release factor 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=prfA PE=3 SV=1 764 1082 5.0E-53
sp|A8EYR1|RF1_RICCK Peptide chain release factor 1 OS=Rickettsia canadensis (strain McKiel) GN=prfA PE=3 SV=1 740 1105 6.0E-53
sp|B9JB75|RF1_AGRRK Peptide chain release factor 1 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=prfA PE=3 SV=1 765 1094 6.0E-53
sp|B3R722|RF1_CUPTR Peptide chain release factor 1 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=prfA PE=3 SV=1 764 1113 6.0E-53
sp|B3EE55|RF1_CHLL2 Peptide chain release factor 1 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=prfA PE=3 SV=1 707 1082 7.0E-53
sp|Q31IN8|RF1_THICR Peptide chain release factor 1 OS=Thiomicrospira crunogena (strain XCL-2) GN=prfA PE=3 SV=1 796 1083 7.0E-53
sp|Q28RD9|RF1_JANSC Peptide chain release factor 1 OS=Jannaschia sp. (strain CCS1) GN=prfA PE=3 SV=1 736 1111 8.0E-53
sp|Q5GWQ9|RF1_XANOR Peptide chain release factor 1 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=prfA PE=3 SV=1 765 1113 8.0E-53
sp|B2SQN5|RF1_XANOP Peptide chain release factor 1 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=prfA PE=3 SV=1 765 1113 8.0E-53
sp|Q2NZW2|RF1_XANOM Peptide chain release factor 1 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=prfA PE=3 SV=1 765 1113 8.0E-53
sp|B4EVR7|RF1_PROMH Peptide chain release factor 1 OS=Proteus mirabilis (strain HI4320) GN=prfA PE=3 SV=1 729 1082 8.0E-53
sp|Q11NS4|RF1_CYTH3 Peptide chain release factor 1 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=prfA PE=3 SV=1 795 1094 8.0E-53
sp|Q110D7|RF1_TRIEI Peptide chain release factor 1 OS=Trichodesmium erythraeum (strain IMS101) GN=prfA PE=3 SV=1 760 1088 8.0E-53
sp|Q21BZ9|RF1_RHOPB Peptide chain release factor 1 OS=Rhodopseudomonas palustris (strain BisB18) GN=prfA PE=3 SV=1 821 1113 9.0E-53
sp|Q6F9S2|RF1_ACIAD Peptide chain release factor 1 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=prfA PE=3 SV=2 729 1085 1.0E-52
sp|A5VYG5|RF1_PSEP1 Peptide chain release factor 1 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=prfA PE=3 SV=1 758 1113 1.0E-52
sp|C5B814|RF1_EDWI9 Peptide chain release factor 1 OS=Edwardsiella ictaluri (strain 93-146) GN=prfA PE=3 SV=1 758 1091 1.0E-52
sp|Q88PW5|RF1_PSEPK Peptide chain release factor 1 OS=Pseudomonas putida (strain KT2440) GN=prfA PE=3 SV=1 758 1113 1.0E-52
sp|Q0BIQ0|RF1_BURCM Peptide chain release factor 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=prfA PE=3 SV=1 776 1082 1.0E-52
sp|B1YSD5|RF1_BURA4 Peptide chain release factor 1 OS=Burkholderia ambifaria (strain MC40-6) GN=prfA PE=3 SV=1 776 1082 1.0E-52
sp|Q03VA1|RF1_LEUMM Peptide chain release factor 1 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=prfA PE=3 SV=1 760 1087 1.0E-52
sp|B7UQ99|RF1_ECO27 Peptide chain release factor 1 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=prfA PE=3 SV=1 758 1091 1.0E-52
sp|A7G9P2|RF1_CLOBL Peptide chain release factor 1 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=prfA PE=3 SV=1 760 1092 2.0E-52
sp|B1IE21|RF1_CLOBK Peptide chain release factor 1 OS=Clostridium botulinum (strain Okra / Type B1) GN=prfA PE=3 SV=1 760 1092 2.0E-52
sp|A1AX02|RF1_RUTMC Peptide chain release factor 1 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=prfA PE=3 SV=1 746 1091 2.0E-52
sp|C5CXW3|RF1_VARPS Peptide chain release factor 1 OS=Variovorax paradoxus (strain S110) GN=prfA PE=3 SV=1 788 1095 2.0E-52
sp|Q8DU64|RF1_STRMU Peptide chain release factor 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=prfA PE=1 SV=1 746 1092 2.0E-52
sp|B1KSR1|RF1_CLOBM Peptide chain release factor 1 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=prfA PE=3 SV=1 760 1092 2.0E-52
sp|Q2S2U3|RF1_SALRD Peptide chain release factor 1 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=prfA PE=3 SV=1 752 1094 2.0E-52
sp|Q39K18|RF1_BURL3 Peptide chain release factor 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=prfA PE=3 SV=1 764 1092 2.0E-52
sp|Q92HK9|RF1_RICCN Peptide chain release factor 1 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=prfA PE=3 SV=1 760 1105 2.0E-52
sp|C4Z1S4|RF1_EUBE2 Peptide chain release factor 1 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=prfA PE=3 SV=1 792 1082 2.0E-52
sp|A5HY35|RF1_CLOBH Peptide chain release factor 1 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=prfA PE=3 SV=1 760 1092 2.0E-52
sp|A7FQG2|RF1_CLOB1 Peptide chain release factor 1 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=prfA PE=3 SV=1 760 1092 2.0E-52
sp|Q1GAX5|RF1_LACDA Peptide chain release factor 1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=prfA PE=3 SV=1 798 1092 2.0E-52
sp|B1GZI5|RF1_UNCTG Peptide chain release factor 1 OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=prfA PE=3 SV=1 795 1092 3.0E-52
sp|Q68WK7|RF1_RICTY Peptide chain release factor 1 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=prfA PE=3 SV=1 740 1092 3.0E-52
sp|Q97F68|RF1_CLOAB Peptide chain release factor 1 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=prfA PE=3 SV=1 760 1082 3.0E-52
sp|Q8PNU5|RF1_XANAC Peptide chain release factor 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=prfA PE=3 SV=1 765 1082 4.0E-52
sp|B9DS45|RF1_STRU0 Peptide chain release factor 1 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=prfA PE=3 SV=1 746 1092 4.0E-52
sp|B2SZ27|RF1_BURPP Peptide chain release factor 1 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=prfA PE=3 SV=1 780 1092 4.0E-52
sp|B4UAY8|RF1_ANASK Peptide chain release factor 1 OS=Anaeromyxobacter sp. (strain K) GN=prfA PE=3 SV=1 760 1096 4.0E-52
sp|B1JEP6|RF1_PSEPW Peptide chain release factor 1 OS=Pseudomonas putida (strain W619) GN=prfA PE=3 SV=1 729 1113 4.0E-52
sp|B4SKS8|RF1_STRM5 Peptide chain release factor 1 OS=Stenotrophomonas maltophilia (strain R551-3) GN=prfA PE=3 SV=1 765 1082 4.0E-52
sp|Q65DV1|RF1_BACLD Peptide chain release factor 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=prfA PE=3 SV=1 733 1092 4.0E-52
sp|Q2GGM5|RF1_EHRCR Peptide chain release factor 1 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=prfA PE=3 SV=1 740 1092 4.0E-52
sp|A0LIZ8|RF1_SYNFM Peptide chain release factor 1 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=prfA PE=3 SV=1 796 1091 4.0E-52
sp|A8YUJ1|RF1_LACH4 Peptide chain release factor 1 OS=Lactobacillus helveticus (strain DPC 4571) GN=prfA PE=3 SV=1 796 1092 5.0E-52
sp|Q2IMW2|RF1_ANADE Peptide chain release factor 1 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=prfA PE=3 SV=1 760 1096 5.0E-52
sp|B0KNE4|RF1_PSEPG Peptide chain release factor 1 OS=Pseudomonas putida (strain GB-1) GN=prfA PE=3 SV=1 758 1083 5.0E-52
sp|Q2LWU9|RF1_SYNAS Peptide chain release factor 1 OS=Syntrophus aciditrophicus (strain SB) GN=prfA PE=3 SV=1 760 1082 5.0E-52
sp|Q3BX07|RF1_XANC5 Peptide chain release factor 1 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=prfA PE=3 SV=1 765 1082 5.0E-52
sp|C1FQ97|RF1_CLOBJ Peptide chain release factor 1 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=prfA PE=3 SV=1 760 1092 5.0E-52
sp|B5YIQ7|RF1_THEYD Peptide chain release factor 1 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=prfA PE=3 SV=1 760 1092 5.0E-52
sp|B8IUB4|RF1_METNO Peptide chain release factor 1 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=prfA PE=3 SV=1 765 1092 6.0E-52
sp|Q2RWE1|RF1_RHORT Peptide chain release factor 1 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=prfA PE=3 SV=1 765 1091 6.0E-52
sp|Q04BB3|RF1_LACDB Peptide chain release factor 1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=prfA PE=3 SV=1 798 1092 6.0E-52
sp|A5N3J7|RF1_CLOK5 Peptide chain release factor 1 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=prfA PE=3 SV=1 760 1092 6.0E-52
sp|Q9K6F4|RF1_BACHD Peptide chain release factor 1 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=prfA PE=3 SV=1 760 1092 6.0E-52
sp|O84026|RF1_CHLTR Peptide chain release factor 1 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=prfA PE=3 SV=1 795 1082 8.0E-52
sp|Q3KMZ9|RF1_CHLTA Peptide chain release factor 1 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=prfA PE=3 SV=1 795 1082 8.0E-52
sp|Q2SUG2|RF1_BURTA Peptide chain release factor 1 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=prfA PE=3 SV=1 776 1092 9.0E-52
sp|B8GLA1|RF1_THISH Peptide chain release factor 1 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=prfA PE=3 SV=1 729 1091 9.0E-52
sp|O67032|RF1_AQUAE Peptide chain release factor 1 OS=Aquifex aeolicus (strain VF5) GN=prfA PE=3 SV=1 729 1108 1.0E-51
sp|A1W4B8|RF1_ACISJ Peptide chain release factor 1 OS=Acidovorax sp. (strain JS42) GN=prfA PE=3 SV=1 788 1102 1.0E-51
sp|B0BB09|RF1_CHLTB Peptide chain release factor 1 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=prfA PE=3 SV=1 795 1082 1.0E-51
sp|B0B9D0|RF1_CHLT2 Peptide chain release factor 1 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=prfA PE=3 SV=1 795 1082 1.0E-51
sp|B0UAV4|RF1_METS4 Peptide chain release factor 1 OS=Methylobacterium sp. (strain 4-46) GN=prfA PE=3 SV=1 765 1092 1.0E-51
sp|A3M6N7|RF1_ACIBT Peptide chain release factor 1 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=prfA PE=3 SV=2 729 1082 1.0E-51
sp|B0VM26|RF1_ACIBS Peptide chain release factor 1 OS=Acinetobacter baumannii (strain SDF) GN=prfA PE=3 SV=1 729 1082 1.0E-51
sp|B2HU82|RF1_ACIBC Peptide chain release factor 1 OS=Acinetobacter baumannii (strain ACICU) GN=prfA PE=3 SV=1 729 1082 1.0E-51
sp|B8JAU2|RF1_ANAD2 Peptide chain release factor 1 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=prfA PE=3 SV=1 760 1096 1.0E-51
sp|Q5NMC7|RF1_ZYMMO Peptide chain release factor 1 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=prfA PE=3 SV=1 758 1092 1.0E-51
sp|A1S8R2|RF1_SHEAM Peptide chain release factor 1 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=prfA PE=3 SV=1 758 1082 1.0E-51
sp|B9ME05|RF1_ACIET Peptide chain release factor 1 OS=Acidovorax ebreus (strain TPSY) GN=prfA PE=3 SV=1 788 1102 1.0E-51
sp|A1UWC9|RF1_BURMS Peptide chain release factor 1 OS=Burkholderia mallei (strain SAVP1) GN=prfA PE=3 SV=1 776 1092 1.0E-51
sp|Q62DF3|RF1_BURMA Peptide chain release factor 1 OS=Burkholderia mallei (strain ATCC 23344) GN=prfA PE=3 SV=1 776 1092 1.0E-51
sp|A2RYL2|RF1_BURM9 Peptide chain release factor 1 OS=Burkholderia mallei (strain NCTC 10229) GN=prfA PE=3 SV=1 776 1092 1.0E-51
sp|A3MFT4|RF1_BURM7 Peptide chain release factor 1 OS=Burkholderia mallei (strain NCTC 10247) GN=prfA PE=3 SV=1 776 1092 1.0E-51
sp|A4SCF1|RF1_CHLPM Peptide chain release factor 1 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=prfA PE=3 SV=1 795 1087 1.0E-51
sp|A1WVQ8|RF1_HALHL Peptide chain release factor 1 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=prfA PE=3 SV=1 746 1087 1.0E-51
sp|B2UL99|RF1_AKKM8 Peptide chain release factor 1 OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=prfA PE=3 SV=1 761 1082 1.0E-51
sp|A6UCF2|RF1_SINMW Peptide chain release factor 1 OS=Sinorhizobium medicae (strain WSM419) GN=prfA PE=3 SV=1 765 1092 1.0E-51
sp|Q87A17|RF1_XYLFT Peptide chain release factor 1 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=prfA PE=3 SV=1 729 1106 1.0E-51
sp|B2IA85|RF1_XYLF2 Peptide chain release factor 1 OS=Xylella fastidiosa (strain M23) GN=prfA PE=3 SV=1 729 1106 1.0E-51
sp|Q63QF0|RF1_BURPS Peptide chain release factor 1 OS=Burkholderia pseudomallei (strain K96243) GN=prfA PE=3 SV=1 776 1092 2.0E-51
sp|A3NE24|RF1_BURP6 Peptide chain release factor 1 OS=Burkholderia pseudomallei (strain 668) GN=prfA PE=3 SV=1 776 1092 2.0E-51
sp|Q3JN85|RF1_BURP1 Peptide chain release factor 1 OS=Burkholderia pseudomallei (strain 1710b) GN=prfA PE=3 SV=1 776 1092 2.0E-51
sp|A3NZS4|RF1_BURP0 Peptide chain release factor 1 OS=Burkholderia pseudomallei (strain 1106a) GN=prfA PE=3 SV=1 776 1092 2.0E-51
sp|Q3YS23|RF1_EHRCJ Peptide chain release factor 1 OS=Ehrlichia canis (strain Jake) GN=prfA PE=3 SV=1 743 1092 2.0E-51
sp|Q3IK95|RF1_PSEHT Peptide chain release factor 1 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=prfA PE=3 SV=1 758 1082 2.0E-51
sp|C3KDC6|RF1_PSEFS Peptide chain release factor 1 OS=Pseudomonas fluorescens (strain SBW25) GN=prfA PE=3 SV=1 758 1113 2.0E-51
sp|Q5FKZ0|RF1_LACAC Peptide chain release factor 1 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=prfA PE=3 SV=1 796 1092 2.0E-51
sp|Q898Y5|RF1_CLOTE Peptide chain release factor 1 OS=Clostridium tetani (strain Massachusetts / E88) GN=prfA PE=3 SV=1 760 1082 2.0E-51
sp|A3CN05|RF1_STRSV Peptide chain release factor 1 OS=Streptococcus sanguinis (strain SK36) GN=prfA PE=3 SV=1 746 1092 2.0E-51
sp|A9AJ68|RF1_BURM1 Peptide chain release factor 1 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=prfA PE=3 SV=1 764 1082 2.0E-51
sp|Q5WB55|RF1_BACSK Peptide chain release factor 1 OS=Bacillus clausii (strain KSM-K16) GN=prfA PE=3 SV=1 760 1092 2.0E-51
sp|B0V7E0|RF1_ACIBY Peptide chain release factor 1 OS=Acinetobacter baumannii (strain AYE) GN=prfA PE=3 SV=1 729 1082 2.0E-51
sp|B7IBA1|RF1_ACIB5 Peptide chain release factor 1 OS=Acinetobacter baumannii (strain AB0057) GN=prfA PE=3 SV=1 729 1082 2.0E-51
sp|B7H0L9|RF1_ACIB3 Peptide chain release factor 1 OS=Acinetobacter baumannii (strain AB307-0294) GN=prfA PE=3 SV=1 729 1082 2.0E-51
sp|B8J4R4|RF1_DESDA Peptide chain release factor 1 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=prfA PE=3 SV=1 782 1099 2.0E-51
sp|A1WI56|RF1_VEREI Peptide chain release factor 1 OS=Verminephrobacter eiseniae (strain EF01-2) GN=prfA PE=3 SV=1 790 1068 2.0E-51
sp|Q3Z776|RF1_DEHM1 Peptide chain release factor 1 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=prfA PE=3 SV=1 795 1092 2.0E-51
sp|B1XSY0|RF1_POLNS Peptide chain release factor 1 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=prfA PE=3 SV=1 789 1082 3.0E-51
sp|B4U955|RF1_HYDS0 Peptide chain release factor 1 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=prfA PE=3 SV=1 729 1082 3.0E-51
sp|B2FQ14|RF1_STRMK Peptide chain release factor 1 OS=Stenotrophomonas maltophilia (strain K279a) GN=prfA PE=3 SV=1 765 1082 3.0E-51
sp|B3PJP4|RF1_CELJU Peptide chain release factor 1 OS=Cellvibrio japonicus (strain Ueda107) GN=prfA PE=3 SV=1 760 1082 3.0E-51
sp|A7HTY3|RF1_PARL1 Peptide chain release factor 1 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=prfA PE=3 SV=1 758 1090 3.0E-51
sp|A0Q312|RF1_CLONN Peptide chain release factor 1 OS=Clostridium novyi (strain NT) GN=prfA PE=3 SV=1 760 1092 3.0E-51
sp|Q38WJ4|RF1_LACSS Peptide chain release factor 1 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=prfA PE=3 SV=1 739 1090 3.0E-51
sp|P45872|RF1_BACSU Peptide chain release factor 1 OS=Bacillus subtilis (strain 168) GN=prfA PE=3 SV=1 760 1092 3.0E-51
sp|Q2Y5P3|RF1_NITMU Peptide chain release factor 1 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=prfA PE=3 SV=1 806 1082 4.0E-51
sp|Q1D2Q9|RF1_MYXXD Peptide chain release factor 1 OS=Myxococcus xanthus (strain DK 1622) GN=prfA PE=3 SV=1 761 1096 4.0E-51
sp|Q93NC7|RF1_MYXXA Peptide chain release factor 1 OS=Myxococcus xanthus GN=prfA PE=3 SV=1 761 1096 4.0E-51
sp|Q5FUR9|RF1_GLUOX Peptide chain release factor 1 OS=Gluconobacter oxydans (strain 621H) GN=prfA PE=3 SV=1 764 1092 4.0E-51
sp|B0K1F7|RF1_THEPX Peptide chain release factor 1 OS=Thermoanaerobacter sp. (strain X514) GN=prfA PE=3 SV=1 827 1092 4.0E-51
sp|Q13TU2|RF1_BURXL Peptide chain release factor 1 OS=Burkholderia xenovorans (strain LB400) GN=prfA PE=3 SV=1 780 1092 5.0E-51
sp|A4JB50|RF1_BURVG Peptide chain release factor 1 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=prfA PE=3 SV=1 764 1082 5.0E-51
sp|Q1AVG5|RF1_RUBXD Peptide chain release factor 1 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=prfA PE=3 SV=1 729 1084 5.0E-51
sp|B0U5Z3|RF1_XYLFM Peptide chain release factor 1 OS=Xylella fastidiosa (strain M12) GN=prfA PE=3 SV=1 729 1106 5.0E-51
sp|Q39YQ1|RF1_GEOMG Peptide chain release factor 1 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=prfA PE=3 SV=1 773 1082 5.0E-51
sp|Q1IEX1|RF1_PSEE4 Peptide chain release factor 1 OS=Pseudomonas entomophila (strain L48) GN=prfA PE=3 SV=1 758 1113 5.0E-51
sp|B0K7G6|RF1_THEP3 Peptide chain release factor 1 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=prfA PE=3 SV=1 733 1092 6.0E-51
sp|B3CL87|RF1_WOLPP Peptide chain release factor 1 OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=prfA PE=3 SV=1 760 1092 7.0E-51
sp|Q0AHU1|RF1_NITEC Peptide chain release factor 1 OS=Nitrosomonas eutropha (strain C91) GN=prfA PE=3 SV=1 803 1082 7.0E-51
[Show less]

GO

GO Term Description Terminal node
GO:0020037 heme binding Yes
GO:0004096 catalase activity Yes
GO:0006415 translational termination Yes
GO:0003747 translation release factor activity Yes
GO:0045182 translation regulator activity No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0043933 protein-containing complex organization No
GO:0097159 organic cyclic compound binding No
GO:0008079 translation termination factor activity No
GO:0004601 peroxidase activity No
GO:0071840 cellular component organization or biogenesis No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0046906 tetrapyrrole binding No
GO:0008135 translation factor activity, RNA binding No
GO:0003674 molecular_function No
GO:0032984 protein-containing complex disassembly No
GO:0022411 cellular component disassembly No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0003676 nucleic acid binding No
GO:0016491 oxidoreductase activity No
GO:0016043 cellular component organization No
GO:0016209 antioxidant activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup68
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|371
Ophiocordyceps australis 1348a (Ghana) OphauG2|3843
Ophiocordyceps australis 1348a (Ghana) OphauG2|7342
Ophiocordyceps australis map64 (Brazil) OphauB2|2376
Ophiocordyceps australis map64 (Brazil) OphauB2|5685
Ophiocordyceps camponoti-floridani Ophcf2|06554
Ophiocordyceps camponoti-floridani Ophcf2|06933
Ophiocordyceps camponoti-rufipedis Ophun1|2887
Ophiocordyceps camponoti-rufipedis Ophun1|6205 (this protein)
Ophiocordyceps kimflemingae Ophio5|2647
Ophiocordyceps kimflemingae Ophio5|3736
Ophiocordyceps subramaniannii Hirsu2|11160
Ophiocordyceps subramaniannii Hirsu2|2168
Ophiocordyceps subramaniannii Hirsu2|2204
Ophiocordyceps subramaniannii Hirsu2|8801

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6205
MAHLIPESIKHKVSGSSERKSSHLQLAGNLVEPSANDRLTADFGTRQSNTDDWLRVNSKDQLGPSLLEDNFGREK
IHRFDHERIPERVVHARGAGAFGTFRLFESAHDVTHAAVLTDTSRETPVFVRFSTVLGSRGSADTVRDVRGFAVK
MYTSEGNWDIVGNNIPVFFIQDAMKFPDLIHAGKPEPGLEIPQAQSAHNNFWDFAFLHSEATHMFMWAMSDRGIP
RSFRMMQGFGVNTYTLVNAAGERCFVKFHFTPELGVASLVWDEALKLCGQDPDFHRKDLAEAIDNGHFPRWRFGI
QTIAESREHEFDFDILDATKLWPEDKVPIRYIGQLELNRNPDEYFTQTEQVAFCTSHVVPGIGFSDDPLLQGRNF
SYFDTQISRIGINWQELPINKPLCPVMNFNRDGAMRHTISKGSVNYWPNRFEAVPPATEKEGGYVDYPAKVMGIK
ERAKSEKFKEHLSQAQLFYNSMSEHEKAHIQAALSFELDHCDDPIVYERMTQRLADIDFNMAKAVANQVAGKLPD
AGKKNPGHKASGLSQTDFMPKEPTVVTRRIAIIIADGFDAVAFNAMQASLKAVGATPIVIAPRRSTISAAGETAS
VMPDHHLEGQRSTMFDALFIPGGEKSVATLMKSGRAIHWVREAFGHLKTIAATGEAVSLIEKALQLDEISMSTSG
EAVESYGVVTLREAKPASLKEVLSVVKGASGFLDKFLHSTSQHRNWQHATSSSLAPSLILRARGISDEYVDLKKK
LELSFDAARAKRAGELQRVATALRAWDEARSAMTELEAMARDPLQDEDLAAIARDELETEKSKLESLERNLSVSL
TPRHPFADLPCMIEFRPGPGGLECRYFADTLFNMYKGFCTRRGLRFSIVKYELADSGGNSTLGELPLLEAVLEVQ
DSGAYDMFRGEAGMHRVQRIPGNDTEHRVHTSAAAVWVLPSSPKDGGVGNADPMDPKSDFYVDPSEVKAEAMRAG
GAGGQHVNKTESAIRLTHLPSGIVVSMQDHRSQQRNREQAWQVLRSRIASQRVEQREAEAARLRSSILAAGQITR
GNKIRTYNYNQDRCSDHRAGIDVHNLPNVLQGGETLDRVMEAAREWLIDVEIRRLTAEEQAKQGQKGQRA*
Coding >Ophun1|6205
ATGGCGCACCTCATCCCAGAGTCAATCAAGCACAAAGTATCGGGCTCCTCCGAGCGAAAGTCGAGCCACTTGCAG
CTGGCGGGCAACTTGGTCGAACCCAGCGCCAACGATCGTCTCACGGCCGATTTTGGCACGAGGCAGAGCAATACG
GACGACTGGCTGCGGGTGAATAGCAAAGACCAACTCGGCCCTTCTCTCCTCGAGGATAACTTTGGTCGCGAAAAG
ATCCATCGCTTTGATCATGAACGAATCCCAGAGCGAGTGGTGCATGCCCGCGGCGCAGGCGCGTTTGGGACGTTC
CGTCTCTTCGAATCTGCCCATGATGTCACGCACGCCGCTGTGCTGACGGACACGAGCCGCGAAACGCCCGTCTTT
GTCCGCTTTTCCACTGTCCTCGGTAGCAGGGGATCGGCAGATACTGTGCGAGACGTGCGTGGCTTCGCCGTCAAG
ATGTATACCAGTGAGGGGAACTGGGACATTGTCGGCAACAATATTCCTGTCTTCTTCATTCAGGACGCGATGAAA
TTCCCGGATCTGATCCATGCGGGAAAGCCAGAGCCTGGCCTTGAGATACCACAAGCACAAAGCGCTCATAACAAC
TTTTGGGACTTTGCCTTTCTGCATTCGGAGGCGACGCACATGTTCATGTGGGCTATGTCAGATCGTGGAATTCCT
CGCAGCTTCCGCATGATGCAGGGCTTCGGCGTCAATACATACACCCTCGTCAACGCAGCCGGCGAGCGCTGCTTT
GTCAAGTTTCACTTCACTCCCGAGCTGGGCGTCGCGTCTCTCGTTTGGGATGAGGCTCTCAAACTGTGTGGACAG
GACCCAGACTTTCACCGCAAGGACTTGGCAGAAGCAATCGACAATGGTCACTTCCCACGTTGGCGTTTCGGCATT
CAGACCATCGCCGAGTCTCGTGAGCACGAGTTCGACTTTGACATTCTCGACGCTACTAAACTTTGGCCCGAGGAC
AAGGTGCCCATCCGATATATCGGTCAGCTCGAGCTGAATCGAAACCCGGACGAGTACTTTACGCAGACTGAGCAA
GTGGCCTTTTGTACCAGCCACGTCGTGCCAGGCATCGGATTTTCCGACGATCCTTTACTGCAAGGGCGCAACTTT
AGTTACTTCGATACCCAGATCTCCAGGATTGGCATTAACTGGCAAGAGCTTCCCATCAACAAGCCCCTTTGCCCC
GTTATGAACTTCAATCGTGATGGAGCCATGCGTCACACAATCAGCAAGGGAAGCGTCAACTACTGGCCAAACCGA
TTTGAGGCCGTTCCGCCGGCCACAGAGAAGGAAGGAGGTTATGTCGATTATCCGGCCAAGGTGATGGGGATTAAG
GAACGGGCGAAGAGCGAAAAGTTCAAGGAGCACTTGTCTCAGGCACAACTCTTTTACAACTCAATGTCGGAACAT
GAGAAAGCTCACATCCAGGCCGCACTGTCGTTCGAATTGGACCACTGCGATGACCCGATTGTTTATGAGCGCATG
ACGCAGCGCCTGGCTGACATCGATTTCAACATGGCCAAAGCTGTTGCAAATCAGGTCGCCGGAAAACTACCAGAC
GCTGGCAAAAAGAACCCTGGACACAAAGCAAGTGGGTTGAGTCAAACGGATTTCATGCCCAAGGAGCCGACTGTT
GTAACTCGTCGCATCGCCATCATTATCGCAGATGGCTTCGACGCCGTTGCTTTCAACGCGATGCAGGCTTCTCTC
AAAGCTGTTGGAGCCACACCTATCGTCATCGCCCCACGCCGCTCTACAATCTCTGCCGCTGGGGAGACGGCATCG
GTCATGCCCGACCACCATCTTGAGGGTCAACGCAGCACCATGTTTGACGCACTTTTCATTCCCGGAGGCGAGAAA
TCTGTCGCGACTTTAATGAAGAGCGGCCGGGCAATCCATTGGGTGCGCGAAGCGTTTGGTCACCTCAAAACAATA
GCTGCAACGGGAGAAGCTGTCTCGCTTATTGAGAAAGCTCTTCAGCTGGATGAGATTTCCATGTCTACAAGCGGA
GAGGCTGTGGAGAGTTATGGAGTTGTTACCCTCCGCGAAGCGAAGCCTGCCAGCCTCAAGGAGGTTCTATCTGTT
GTGAAGGGTGCAAGCGGGTTCTTGGACAAGTTCCTTCATTCGACGAGTCAGCATCGTAACTGGCAGCACGCAACA
TCGAGCTCCCTCGCACCCAGCCTTATTCTCCGCGCCAGAGGCATTTCGGACGAATACGTCGACCTGAAGAAGAAG
CTGGAGCTGTCGTTCGACGCCGCGCGGGCGAAGCGCGCGGGGGAGCTGCAGCGGGTCGCCACGGCGCTGCGGGCA
TGGGACGAAGCTCGCAGCGCAATGACGGAGCTCGAGGCCATGGCGCGGGACCCTTTACAGGACGAGGATCTCGCC
GCCATCGCCCGCGACGAGCTGGAGACGGAAAAGTCCAAGCTCGAGTCTCTCGAACGGAATCTGTCGGTGAGCCTG
ACGCCCCGTCACCCCTTCGCCGACCTGCCTTGCATGATCGAGTTTCGTCCCGGCCCTGGCGGCCTCGAGTGCCGT
TACTTTGCCGACACGCTCTTCAATATGTACAAGGGCTTCTGTACGCGCAGGGGCTTGCGCTTCAGCATCGTCAAG
TATGAGTTGGCCGACTCTGGCGGCAACTCAACCCTAGGCGAGCTTCCGTTACTAGAGGCCGTCCTCGAAGTGCAA
GACTCGGGAGCGTACGACATGTTTCGCGGCGAGGCCGGTATGCACCGCGTCCAACGGATTCCCGGCAATGACACC
GAACACCGCGTACACACGAGCGCTGCCGCCGTCTGGGTGCTCCCCTCCTCACCGAAGGACGGCGGTGTGGGGAAT
GCCGACCCGATGGACCCCAAGAGCGACTTCTACGTCGATCCCAGCGAGGTCAAAGCCGAGGCGATGCGCGCGGGG
GGCGCTGGCGGCCAGCACGTCAACAAGACGGAGTCGGCAATCCGGCTGACGCACTTGCCCTCCGGCATCGTCGTC
TCGATGCAGGATCATCGGTCACAGCAGCGTAATCGTGAGCAAGCGTGGCAGGTGCTCCGATCGCGAATCGCCAGT
CAACGCGTGGAGCAGCGTGAGGCCGAGGCGGCGCGACTGCGGTCCAGCATCCTGGCGGCGGGACAGATTACGCGG
GGTAACAAAATCCGGACCTACAACTACAACCAAGACCGATGCTCCGATCACCGCGCCGGCATCGATGTGCACAAC
TTACCCAACGTTTTACAAGGGGGCGAGACGCTAGATCGTGTCATGGAAGCGGCCAGAGAGTGGCTAATTGACGTC
GAGATTCGAAGACTTACAGCCGAGGAGCAGGCAAAGCAGGGACAAAAGGGCCAGCGGGCCTGA
Transcript >Ophun1|6205
ATGGCGCACCTCATCCCAGAGTCAATCAAGCACAAAGTATCGGGCTCCTCCGAGCGAAAGTCGAGCCACTTGCAG
CTGGCGGGCAACTTGGTCGAACCCAGCGCCAACGATCGTCTCACGGCCGATTTTGGCACGAGGCAGAGCAATACG
GACGACTGGCTGCGGGTGAATAGCAAAGACCAACTCGGCCCTTCTCTCCTCGAGGATAACTTTGGTCGCGAAAAG
ATCCATCGCTTTGATCATGAACGAATCCCAGAGCGAGTGGTGCATGCCCGCGGCGCAGGCGCGTTTGGGACGTTC
CGTCTCTTCGAATCTGCCCATGATGTCACGCACGCCGCTGTGCTGACGGACACGAGCCGCGAAACGCCCGTCTTT
GTCCGCTTTTCCACTGTCCTCGGTAGCAGGGGATCGGCAGATACTGTGCGAGACGTGCGTGGCTTCGCCGTCAAG
ATGTATACCAGTGAGGGGAACTGGGACATTGTCGGCAACAATATTCCTGTCTTCTTCATTCAGGACGCGATGAAA
TTCCCGGATCTGATCCATGCGGGAAAGCCAGAGCCTGGCCTTGAGATACCACAAGCACAAAGCGCTCATAACAAC
TTTTGGGACTTTGCCTTTCTGCATTCGGAGGCGACGCACATGTTCATGTGGGCTATGTCAGATCGTGGAATTCCT
CGCAGCTTCCGCATGATGCAGGGCTTCGGCGTCAATACATACACCCTCGTCAACGCAGCCGGCGAGCGCTGCTTT
GTCAAGTTTCACTTCACTCCCGAGCTGGGCGTCGCGTCTCTCGTTTGGGATGAGGCTCTCAAACTGTGTGGACAG
GACCCAGACTTTCACCGCAAGGACTTGGCAGAAGCAATCGACAATGGTCACTTCCCACGTTGGCGTTTCGGCATT
CAGACCATCGCCGAGTCTCGTGAGCACGAGTTCGACTTTGACATTCTCGACGCTACTAAACTTTGGCCCGAGGAC
AAGGTGCCCATCCGATATATCGGTCAGCTCGAGCTGAATCGAAACCCGGACGAGTACTTTACGCAGACTGAGCAA
GTGGCCTTTTGTACCAGCCACGTCGTGCCAGGCATCGGATTTTCCGACGATCCTTTACTGCAAGGGCGCAACTTT
AGTTACTTCGATACCCAGATCTCCAGGATTGGCATTAACTGGCAAGAGCTTCCCATCAACAAGCCCCTTTGCCCC
GTTATGAACTTCAATCGTGATGGAGCCATGCGTCACACAATCAGCAAGGGAAGCGTCAACTACTGGCCAAACCGA
TTTGAGGCCGTTCCGCCGGCCACAGAGAAGGAAGGAGGTTATGTCGATTATCCGGCCAAGGTGATGGGGATTAAG
GAACGGGCGAAGAGCGAAAAGTTCAAGGAGCACTTGTCTCAGGCACAACTCTTTTACAACTCAATGTCGGAACAT
GAGAAAGCTCACATCCAGGCCGCACTGTCGTTCGAATTGGACCACTGCGATGACCCGATTGTTTATGAGCGCATG
ACGCAGCGCCTGGCTGACATCGATTTCAACATGGCCAAAGCTGTTGCAAATCAGGTCGCCGGAAAACTACCAGAC
GCTGGCAAAAAGAACCCTGGACACAAAGCAAGTGGGTTGAGTCAAACGGATTTCATGCCCAAGGAGCCGACTGTT
GTAACTCGTCGCATCGCCATCATTATCGCAGATGGCTTCGACGCCGTTGCTTTCAACGCGATGCAGGCTTCTCTC
AAAGCTGTTGGAGCCACACCTATCGTCATCGCCCCACGCCGCTCTACAATCTCTGCCGCTGGGGAGACGGCATCG
GTCATGCCCGACCACCATCTTGAGGGTCAACGCAGCACCATGTTTGACGCACTTTTCATTCCCGGAGGCGAGAAA
TCTGTCGCGACTTTAATGAAGAGCGGCCGGGCAATCCATTGGGTGCGCGAAGCGTTTGGTCACCTCAAAACAATA
GCTGCAACGGGAGAAGCTGTCTCGCTTATTGAGAAAGCTCTTCAGCTGGATGAGATTTCCATGTCTACAAGCGGA
GAGGCTGTGGAGAGTTATGGAGTTGTTACCCTCCGCGAAGCGAAGCCTGCCAGCCTCAAGGAGGTTCTATCTGTT
GTGAAGGGTGCAAGCGGGTTCTTGGACAAGTTCCTTCATTCGACGAGTCAGCATCGTAACTGGCAGCACGCAACA
TCGAGCTCCCTCGCACCCAGCCTTATTCTCCGCGCCAGAGGCATTTCGGACGAATACGTCGACCTGAAGAAGAAG
CTGGAGCTGTCGTTCGACGCCGCGCGGGCGAAGCGCGCGGGGGAGCTGCAGCGGGTCGCCACGGCGCTGCGGGCA
TGGGACGAAGCTCGCAGCGCAATGACGGAGCTCGAGGCCATGGCGCGGGACCCTTTACAGGACGAGGATCTCGCC
GCCATCGCCCGCGACGAGCTGGAGACGGAAAAGTCCAAGCTCGAGTCTCTCGAACGGAATCTGTCGGTGAGCCTG
ACGCCCCGTCACCCCTTCGCCGACCTGCCTTGCATGATCGAGTTTCGTCCCGGCCCTGGCGGCCTCGAGTGCCGT
TACTTTGCCGACACGCTCTTCAATATGTACAAGGGCTTCTGTACGCGCAGGGGCTTGCGCTTCAGCATCGTCAAG
TATGAGTTGGCCGACTCTGGCGGCAACTCAACCCTAGGCGAGCTTCCGTTACTAGAGGCCGTCCTCGAAGTGCAA
GACTCGGGAGCGTACGACATGTTTCGCGGCGAGGCCGGTATGCACCGCGTCCAACGGATTCCCGGCAATGACACC
GAACACCGCGTACACACGAGCGCTGCCGCCGTCTGGGTGCTCCCCTCCTCACCGAAGGACGGCGGTGTGGGGAAT
GCCGACCCGATGGACCCCAAGAGCGACTTCTACGTCGATCCCAGCGAGGTCAAAGCCGAGGCGATGCGCGCGGGG
GGCGCTGGCGGCCAGCACGTCAACAAGACGGAGTCGGCAATCCGGCTGACGCACTTGCCCTCCGGCATCGTCGTC
TCGATGCAGGATCATCGGTCACAGCAGCGTAATCGTGAGCAAGCGTGGCAGGTGCTCCGATCGCGAATCGCCAGT
CAACGCGTGGAGCAGCGTGAGGCCGAGGCGGCGCGACTGCGGTCCAGCATCCTGGCGGCGGGACAGATTACGCGG
GGTAACAAAATCCGGACCTACAACTACAACCAAGACCGATGCTCCGATCACCGCGCCGGCATCGATGTGCACAAC
TTACCCAACGTTTTACAAGGGGGCGAGACGCTAGATCGTGTCATGGAAGCGGCCAGAGAGTGGCTAATTGACGTC
GAGATTCGAAGACTTACAGCCGAGGAGCAGGCAAAGCAGGGACAAAAGGGCCAGCGGGCCTGA
Gene >Ophun1|6205
ATGGCGCACCTCATCCCAGAGTCAATCAAGCACAAAGTATCGGGCTCCTCCGAGCGAAAGTCGAGCCACTTGCAG
CTGGCGGGCAACTTGGTCGAACCCAGCGCCAACGATCGTCTCACGGCCGATTTTGGCACGAGGCAGAGCAATACG
GACGACTGGCTGCGGGTGAATAGCAAAGACCAACTCGGCCCTTCTCTCCTCGAGGATAACTTTGGTCGCGAAAAG
GTCAGCTTACCAGGCGAGGAGCTGTAATTGTCGTTTGATACTAATAAACCTCGCTACCAGATCCATCGCTTTGAT
CATGAACGAATCCCAGAGCGAGTGGTGCATGCCCGCGGCGCAGGCGCGTTTGGGACGTTCCGTCTCTTCGAATCT
GCCCATGATGTCACGCACGCCGCTGTGCTGACGGACACGAGCCGCGAAACGCCCGTCTTTGTCCGCTTTTCCACT
GTCCTCGGTAGCAGGGGATCGGCAGATACTGTGCGAGACGTGCGTGGCTTCGCCGTCAAGATGTATACCAGTGAG
GGGAACTGGGACATTGTCGGCAACAATATTCCTGTCTTCTTCATTCAGGACGCGATGAAATTCCCGGATCTGATC
CATGCGGGAAAGCCAGAGCCTGGCCTTGAGATACCACAAGCACAAAGCGCTCATAACAACTTTTGGGACTTTGCC
TTTCTGCATTCGGAGGCGACGCACATGTTCATGTGGGCTATGTCAGATCGTGGAATTCCTCGCAGTACGTTCATT
ATATCTCCTTGACGTGGCTGGACAGTCGCTGATGGCTCTTAGGCTTCCGCATGATGCAGGGCTTCGGCGTCAATA
CATACACCCTCGTCAACGCAGCCGGCGAGCGCTGCTTTGTCAAGTTTCACTTCACTCCCGAGCTGGGCGTCGCGT
CTCTCGTTTGGGATGAGGCTCTCAAACTGTGTGGACAGGACCCAGACTTTCACCGCAAGGACTTGGCAGAAGCAA
TCGACAATGGTCACTTCCCACGTTGGCGTTTCGGCATTCAGACCATCGCCGAGTCTCGTGAGCACGAGTTCGACT
TTGACATTCTCGACGCTACTAAACTTTGGCCCGAGGACAAGGTGCCCATCCGATATATCGGTCAGCTCGAGCTGA
ATCGAAACCCGGACGAGTACTTTACGCAGACTGAGCAAGTGGCCTTTTGTACCAGCCACGTCGTGCCAGGCATCG
GATTTTCCGACGATCCTTTACTGCAAGGGCGCAACTTTAGTTACTTCGATACCCAGATCTCCAGGATTGGCATTA
ACTGGCAAGAGCTTCCCATCAACAAGCCCCTTTGCCCCGTTATGAACTTCAATCGTGATGGAGCCATGCGTCACA
CAATCAGCAAGGGAAGCGTCAACTACTGGCCAAACCGATTTGAGGCCGTTCCGCCGGCCACAGAGAAGGAAGGAG
GTTATGTCGATTATCCGGCCAAGGTGATGGGGATTAAGGAACGGGCGAAGAGCGAAAAGTTCAAGGAGCACTTGT
CTCAGGCACAACTCTTTTACAACTCAATGTCGGAACATGAGAAAGCTCACATCCAGGCCGCACTGTCGTTCGAAT
TGGACCACTGCGATGACCCGATTGTTTATGAGCGCATGACGCAGCGCCTGGCTGACATCGATTTCAACATGGCCA
AAGCTGTTGCAAATCAGGTCGCCGGAAAACTACCAGACGCTGGCAAAAAGAACCCTGGACACAAAGCAAGTGGGT
TGAGTCAAACGGATTTCATGCCCAAGGAGCCGACTGTTGTAACTCGTCGCATCGCCATCATTATCGCAGATGGCT
TCGACGCCGTTGCTTTCAACGCGATGCAGGCTTCTCTCAAAGCTGTTGGAGCCACACCTATCGTCATCGCCCCAC
GCCGCTCTACAATCTCTGCCGCTGGGGAGACGGCATCGGTCATGCCCGACCACCATCTTGAGGGTCAACGCAGCA
CCATGTTTGACGCACTTTTCATTCCCGGAGGCGAGAAATCTGTCGCGACTTTAATGAAGAGCGGCCGGGCAATCC
ATTGGGTGCGCGAAGCGTTTGGTCACCTCAAAACAATAGCTGCAACGGGAGAAGCTGTCTCGCTTATTGAGAAAG
CTCTTCAGCTGGATGAGATTTCCATGTCTACAAGCGGAGAGGCTGTGGAGAGTTATGGAGTTGTTACCCTCCGCG
AAGCGAAGCCTGCCAGCCTCAAGGAGGTTCTATCTGTTGTGAAGGGTGCAAGCGGGTTCTTGGACAAGTTCCTTC
ATTCGACGAGTCAGCATCGTAACTGGCAGCGTGAGCTGGATGGCTTGAGCAGTCTTGTGGCATATTAGGCGTAGA
TGCGGGTTATCTGCGGAACAGTGGCTGGGATGTCTCTCTGTATATATCGCGTAATGTAGAAGGACCGGAACGAAT
TATCTACTCTCTTTGCAGCAGACTGAGGGAAGTCTATGATGCTTCCAGGTCGACGCGACTTTGGCAACTAGGTAC
TTTCACAATACGTGTCGTATTGTGTCAGACTTAACATCAACGCAGCTAACCATGAACGACTCTGGTCCGTTTCGC
ATTGAGTGTCAGAAGTCGAATATCAGGTTGTTTGATGGCCAGACGCTGCTTGTGTATGCCATATATACATCAATA
GCACCCCGAAAAACGCACTGCCTCTATAGCTCAGTGGTAGAGCGTTACACTTGTACTCTGCCTGAGCGATGTAAA
GGCCTGTGGTTCGACTCCGCATGGAGGCTAGTGGCAAATATTTTTGCACCTCCAACTTCCTAGTCAAACCTGTCG
TCCTACCTTATATCGTTCTTTTTTGTCGTTCTTTTTTCTAGGAATATTGCCATCGACGATTACCAGGTCTAGCCA
AATCTGCCATGCCTAGGATTCACGCAGGAACGATGGCTGGTTGCTTGTGTTAACGAGAATAGCAACGCATATCAT
CGATCACGTGCGTGCAGCCAAGCCGTCGACTACATCTCTTGCAAACCGTCATCTTGTTGCTGATGATCCCCCTTT
TCCTGCAACAGCATGCTCTCTGCAGCTACGTGGCTCTGCCACAGCTGCGTCAGAACTGTGCGCCGCGTTCGGTTC
ATCACCAATGGTAGGTATTCTTTTGTTAAAAATTTCTGATACCCGAGCACTGAGGCTAAATCACCCCCAGACGCA
ACATCGAGCTCCCTCGCACCCAGCCTTATTCTCCGCGCCAGAGGCATTTCGGACGAATACGTCGACCTGAAGAAG
AAGCTGGAGCTGTCGTTCGACGCCGCGCGGGCGAAGCGCGCGGGGGAGCTGCAGCGGGTCGCCACGGCGCTGCGG
GCATGGGACGAAGCTCGCAGCGCAATGACGGAGCTCGAGGCCATGGCGCGGGACCCTTTACAGGACGAGGATCTC
GCCGCCATCGCCCGCGACGAGCTGGAGACGGAAAAGTCCAAGCTCGAGTCTCTCGAACGGAATCTGTCGGTGAGC
CTGACGCCCCGTCACCCCTTCGCCGACCTGCCTTGCATGATCGAGTTTCGTCCCGGCCCTGGCGGCCTCGAGTGC
CGTTACTTTGCCGACACGCTCTTCAATATGTACAAGGGCTTCTGTACGCGCAGGGGCTTGCGCTTCAGCATCGTC
AAGTATGAGTTGGCCGACTCTGGCGGCAACTCAACCCTAGGCGAGCTTCCGTTACTAGAGGCCGTCCTCGAAGTG
CAAGACTCGGGAGCGTACGACATGTTTCGCGGCGAGGCCGGTATGCACCGCGTCCAACGGATTCCCGGCAATGAC
ACCGAACACCGCGTACACACGAGCGCTGCCGCCGTCTGGGTGCTCCCCTCCTCACCGAAGGACGGCGGTGTGGGG
AATGCCGACCCGATGGACCCCAAGAGCGACTTCTACGTCGATCCCAGCGAGGTCAAAGCCGAGGCGATGCGCGCG
GGGGGCGCTGGCGGCCAGCACGTCAACAAGACGGAGTCGGCAATCCGGCTGACGCACTTGCCCTCCGGCATCGTC
GTCTCGATGCAGGATCATCGGTCACAGCAGCGTAATCGTGAGCAAGCGTGGCAGGTGCTCCGATCGCGAATCGCC
AGTCAACGCGTGGAGCAGCGTGAGGCCGAGGCGGCGCGACTGCGGTCCAGCATCCTGGCGGCGGGACAGATTACG
CGGGGTAACAAAATCCGGACCTACAACTACAACCAAGACCGATGCTCCGATCACCGCGCCGGCATCGATGTGCAC
AACTTACCCAACGTTTTACAAGGGGGCGAGACGCTAGATCGTGTCATGGAAGCGGCCAGAGAGTGGCTAATTGAC
GTCGAGATTCGAAGACTTACAGCCGAGGAGCAGGCAAAGCAGGGACAAAAGGGCCAGCGGGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail