Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6201
Gene name
LocationContig_66:36272..38243
Strand+
Gene length (bp)1971
Transcript length (bp)1419
Coding sequence length (bp)1419
Protein length (aa) 473

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 2.7E-31 183 449

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94142|KO1_GIBFU Ent-kaurene oxidase OS=Gibberella fujikuroi GN=CYP503A1 PE=1 SV=1 30 471 7.0E-71
sp|Q701P2|KO1_GIBIN Ent-kaurene oxidase OS=Gibberella intermedia GN=CYP503A1 PE=1 SV=1 30 471 1.0E-70
sp|B9WZX6|FTMG_ASPFM Fumitremorgin C monooxygenase OS=Neosartorya fumigata GN=ftmP450-3 PE=1 SV=1 166 472 9.0E-35
sp|Q4WAX0|FTMG_ASPFU Fumitremorgin C monooxygenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-3 PE=3 SV=1 166 446 1.0E-33
sp|A1DA65|FTMG_NEOFI Fumitremorgin C monooxygenase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-3 PE=3 SV=1 166 472 2.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94142|KO1_GIBFU Ent-kaurene oxidase OS=Gibberella fujikuroi GN=CYP503A1 PE=1 SV=1 30 471 7.0E-71
sp|Q701P2|KO1_GIBIN Ent-kaurene oxidase OS=Gibberella intermedia GN=CYP503A1 PE=1 SV=1 30 471 1.0E-70
sp|B9WZX6|FTMG_ASPFM Fumitremorgin C monooxygenase OS=Neosartorya fumigata GN=ftmP450-3 PE=1 SV=1 166 472 9.0E-35
sp|Q4WAX0|FTMG_ASPFU Fumitremorgin C monooxygenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-3 PE=3 SV=1 166 446 1.0E-33
sp|A1DA65|FTMG_NEOFI Fumitremorgin C monooxygenase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-3 PE=3 SV=1 166 472 2.0E-33
sp|Q9Y7C8|LOVA_ASPTE Dihydromonacolin L monooxygenase LovA OS=Aspergillus terreus GN=lovA PE=1 SV=1 166 441 3.0E-27
sp|Q9UVC3|CP51_CUNEL Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 192 449 1.0E-18
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 189 457 1.0E-15
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 182 439 1.0E-13
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 207 468 9.0E-13
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 264 438 3.0E-12
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 232 471 3.0E-12
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 150 445 5.0E-12
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 219 457 6.0E-12
sp|Q9WVK8|CP46A_MOUSE Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 195 446 6.0E-12
sp|Q9Y6A2|CP46A_HUMAN Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 195 446 8.0E-12
sp|Q02318|CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 182 438 8.0E-12
sp|P13584|CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 199 440 2.0E-11
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 219 471 3.0E-11
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 219 471 3.0E-11
sp|Q9V4U7|C6A14_DROME Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 230 450 4.0E-11
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 199 440 6.0E-11
sp|Q8N118|CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 217 451 6.0E-11
sp|P58048|C71B8_ARATH Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 260 447 9.0E-11
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 264 438 1.0E-10
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 264 445 4.0E-10
sp|Q9LTM7|C71BG_ARATH Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=CYP71B16 PE=3 SV=1 234 447 5.0E-10
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 199 440 6.0E-10
sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 194 443 8.0E-10
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 217 438 9.0E-10
sp|P37124|C77A2_SOLME Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1 189 455 9.0E-10
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 223 445 1.0E-09
sp|Q6Z5I7|C76M6_ORYSJ Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 212 466 1.0E-09
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 267 438 1.0E-09
sp|O00061|CP67_UROFA Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 185 445 2.0E-09
sp|P37123|C77A1_SOLME Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 162 443 2.0E-09
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 182 439 2.0E-09
sp|P14263|CP51_CANTR Lanosterol 14-alpha demethylase OS=Candida tropicalis GN=ERG11 PE=3 SV=2 152 441 2.0E-09
sp|Q9V7G5|C4AA1_DROME Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 178 440 2.0E-09
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 228 452 3.0E-09
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 267 438 4.0E-09
sp|Q60991|CP7B1_MOUSE 25-hydroxycholesterol 7-alpha-hydroxylase OS=Mus musculus GN=Cyp7b1 PE=2 SV=2 235 453 4.0E-09
sp|Q9K498|EIZFM_STRCO Epi-isozizaene 5-monooxygenase/(E)-beta-farnesene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5223 PE=1 SV=1 178 459 4.0E-09
sp|O75881|CP7B1_HUMAN 25-hydroxycholesterol 7-alpha-hydroxylase OS=Homo sapiens GN=CYP7B1 PE=1 SV=2 247 453 5.0E-09
sp|P58051|C71BE_ARATH Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 219 463 5.0E-09
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 264 440 5.0E-09
sp|Q42600|C84A1_ARATH Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=1 SV=1 258 445 6.0E-09
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 267 450 6.0E-09
sp|Q6YTF5|C76M5_ORYSJ Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 234 447 7.0E-09
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 234 449 7.0E-09
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 118 455 8.0E-09
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 223 449 8.0E-09
sp|Q6WKZ0|C7D94_MENGR Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1 260 445 9.0E-09
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 182 439 1.0E-08
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 118 455 1.0E-08
sp|O64638|C76C3_ARATH Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 216 445 1.0E-08
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 183 441 1.0E-08
sp|Q9V419|C28A5_DROME Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 136 448 1.0E-08
sp|P17177|CP27A_RABIT Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 182 440 1.0E-08
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 269 443 1.0E-08
sp|Q96514|C71B7_ARATH Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=1 SV=1 228 456 2.0E-08
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 267 438 2.0E-08
sp|P10613|CP51_CANAL Lanosterol 14-alpha demethylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG11 PE=3 SV=2 192 442 2.0E-08
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 190 452 2.0E-08
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 199 451 2.0E-08
sp|O65788|C71B2_ARATH Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 228 446 2.0E-08
sp|O22307|C71DB_LOTJA Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 260 445 2.0E-08
sp|Q64505|CP7A1_MOUSE Cholesterol 7-alpha-monooxygenase OS=Mus musculus GN=Cyp7a1 PE=2 SV=2 256 448 2.0E-08
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 267 450 2.0E-08
sp|B9G934|C14C3_ORYSJ Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 233 440 2.0E-08
sp|P48416|CP10_LYMST Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 264 450 2.0E-08
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 234 457 3.0E-08
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 264 438 3.0E-08
sp|Q1ZXH9|CP51_DICDI Probable lanosterol 14-alpha demethylase OS=Dictyostelium discoideum GN=cyp51 PE=3 SV=1 192 439 3.0E-08
sp|Q63688|CP7B1_RAT 25-hydroxycholesterol 7-alpha-hydroxylase (Fragment) OS=Rattus norvegicus GN=Cyp7b1 PE=1 SV=1 246 453 4.0E-08
sp|Q9EP75|CP4FE_MOUSE Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 267 438 4.0E-08
sp|Q964R1|CP6J1_BLAGE Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 182 439 5.0E-08
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 264 450 6.0E-08
sp|Q964T2|CP9E2_BLAGE Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 246 450 6.0E-08
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 248 441 6.0E-08
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 234 469 6.0E-08
sp|Q9STL1|C71AM_ARATH Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 128 444 7.0E-08
sp|O46420|CP51A_PIG Lanosterol 14-alpha demethylase OS=Sus scrofa GN=CYP51A1 PE=2 SV=1 179 451 8.0E-08
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 209 450 8.0E-08
sp|P22680|CP7A1_HUMAN Cholesterol 7-alpha-monooxygenase OS=Homo sapiens GN=CYP7A1 PE=1 SV=2 256 448 8.0E-08
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 209 450 9.0E-08
sp|Q43078|C97B1_PEA Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 182 432 9.0E-08
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 234 469 1.0E-07
sp|P82711|C6A19_DROME Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 186 450 1.0E-07
sp|Q94FM7|C71DK_TOBAC 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 233 445 1.0E-07
sp|P79304|CP193_PIG Aromatase 3 OS=Sus scrofa GN=CYP19A3 PE=2 SV=2 199 445 1.0E-07
sp|O46491|CP7A1_PIG Cholesterol 7-alpha-monooxygenase OS=Sus scrofa GN=CYP7A1 PE=3 SV=1 258 448 1.0E-07
sp|O64989|C90B1_ARATH Cytochrome P450 90B1 OS=Arabidopsis thaliana GN=CYP90B1 PE=1 SV=2 215 472 1.0E-07
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 267 438 1.0E-07
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 234 441 1.0E-07
sp|Q9XHE8|C71DI_MENSP Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 263 445 1.0E-07
sp|Q6WKZ1|C71DI_MENGR Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 263 445 1.0E-07
sp|P15539|C11B2_MOUSE Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 269 435 1.0E-07
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 234 441 1.0E-07
sp|P08516|CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 267 450 2.0E-07
sp|P18125|CP7A1_RAT Cholesterol 7-alpha-monooxygenase OS=Rattus norvegicus GN=Cyp7a1 PE=1 SV=1 256 448 2.0E-07
sp|P46634|CP7A1_CRIGR Cholesterol 7-alpha-monooxygenase OS=Cricetulus griseus GN=CYP7A1 PE=3 SV=1 256 444 2.0E-07
sp|Q6XQ14|C71E7_MANES 2-methylbutanal oxime monooxygenase OS=Manihot esculenta GN=CYP71E7 PE=1 SV=1 223 461 2.0E-07
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 218 450 2.0E-07
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 259 441 2.0E-07
sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 220 445 2.0E-07
sp|F4JW83|C84A4_ARATH Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 269 445 2.0E-07
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 234 441 2.0E-07
sp|P15393|C11B1_RAT Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 264 426 2.0E-07
sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 234 465 2.0E-07
sp|Q9VCW1|CP6D4_DROME Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 259 439 3.0E-07
sp|Q9LTM0|C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 228 447 3.0E-07
sp|D5J9U8|GAO_LACSA Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 266 447 3.0E-07
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 215 448 3.0E-07
sp|Q9SCN2|C71BU_ARATH Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=CYP71B31 PE=2 SV=1 234 447 3.0E-07
sp|P51542|CP7A1_RABIT Cholesterol 7-alpha-monooxygenase OS=Oryctolagus cuniculus GN=CYP7A1 PE=1 SV=1 256 442 3.0E-07
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 185 446 4.0E-07
sp|P49602|CP51_USTMA Lanosterol 14-alpha demethylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG11 PE=3 SV=1 192 444 4.0E-07
sp|Q9VE00|C12A4_DROME Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 264 458 4.0E-07
sp|P50859|CP51_CANGA Lanosterol 14-alpha demethylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG11 PE=3 SV=1 143 449 4.0E-07
sp|Q12609|STCF_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 264 440 4.0E-07
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 267 450 4.0E-07
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 234 469 5.0E-07
sp|Q59990|CP120_SYNY3 Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 185 447 5.0E-07
sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 264 438 5.0E-07
sp|O88833|CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 267 440 5.0E-07
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 201 469 5.0E-07
sp|Q9LZ31|C77A4_ARATH Cytochrome P450 77A4 OS=Arabidopsis thaliana GN=CYP77A4 PE=2 SV=1 189 446 5.0E-07
sp|O48928|C77A3_SOYBN Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 189 443 5.0E-07
sp|Q9STK9|C71AO_ARATH Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 222 447 5.0E-07
sp|Q9SAE3|C71BS_ARATH Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=CYP71B28 PE=2 SV=1 228 444 5.0E-07
sp|Q64408|C11B1_CAVPO Cytochrome P450 11B1, mitochondrial OS=Cavia porcellus GN=CYP11B1 PE=2 SV=1 261 435 6.0E-07
sp|Q9XHE7|C71DD_MENPI Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1 263 445 6.0E-07
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 234 441 6.0E-07
sp|Q9LTM3|C71BK_ARATH Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1 233 447 6.0E-07
sp|P51663|C11B1_SHEEP Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 269 435 6.0E-07
sp|Q29552|C11B1_PIG Cytochrome P450 11B1, mitochondrial OS=Sus scrofa GN=CYP11B1 PE=2 SV=1 269 441 7.0E-07
sp|Q9SXS3|C93C2_GLYEC 2-hydroxyisoflavanone synthase OS=Glycyrrhiza echinata GN=CYP93C2 PE=1 SV=1 191 445 7.0E-07
sp|Q9GQM9|CP6L1_BLAGE Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 234 460 7.0E-07
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 259 440 7.0E-07
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 224 445 7.0E-07
sp|Q4R8S6|CP51A_MACFA Lanosterol 14-alpha demethylase OS=Macaca fascicularis GN=CYP51A1 PE=2 SV=2 179 451 7.0E-07
sp|Q9V979|CP6U1_DROME Probable cytochrome P450 6u1 OS=Drosophila melanogaster GN=Cyp6u1 PE=2 SV=3 236 463 8.0E-07
sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 233 445 8.0E-07
sp|Q6NT55|CP4FN_HUMAN Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 267 455 9.0E-07
sp|P49264|C71B1_THLAR Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 219 445 9.0E-07
sp|Q02928|CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 209 450 9.0E-07
sp|P28649|CP19A_MOUSE Aromatase OS=Mus musculus GN=Cyp19a1 PE=2 SV=1 199 441 9.0E-07
sp|O65012|C78A4_PINRA Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 185 440 9.0E-07
sp|Q5RE72|CP51A_PONAB Lanosterol 14-alpha demethylase OS=Pongo abelii GN=CYP51A1 PE=2 SV=2 179 451 1.0E-06
sp|P97720|C11B1_MESAU Cytochrome P450 11B1, mitochondrial OS=Mesocricetus auratus GN=CYP11B1 PE=2 SV=1 269 470 1.0E-06
sp|Q9VS79|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 205 440 1.0E-06
sp|P48419|C75A3_PETHY Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 231 456 1.0E-06
sp|Q07217|CP11A_ONCMY Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 269 435 1.0E-06
sp|Q64658|C11B2_MESAU Cytochrome P450 11B2, mitochondrial OS=Mesocricetus auratus GN=CYP11B2 PE=2 SV=1 277 470 1.0E-06
sp|Q9VMT6|C28D2_DROME Probable cytochrome P450 28d2 OS=Drosophila melanogaster GN=Cyp28d2 PE=3 SV=1 233 441 1.0E-06
sp|Q5QQX7|CP19A_CANLF Aromatase OS=Canis lupus familiaris GN=CYP19A1 PE=2 SV=1 199 445 1.0E-06
sp|Q9XS28|CP19A_SHEEP Aromatase OS=Ovis aries GN=CYP19A1 PE=2 SV=1 198 445 1.0E-06
sp|Q6YI21|CP19A_CAPHI Aromatase OS=Capra hircus GN=CYP19A1 PE=2 SV=1 198 445 1.0E-06
sp|P48418|C75A1_PETHY Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 234 456 1.0E-06
sp|Q29624|CP191_PIG Aromatase 1 OS=Sus scrofa GN=CYP19A1 PE=2 SV=1 199 444 1.0E-06
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 205 443 1.0E-06
sp|D5JBW9|GAO_SAUCO Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 266 447 1.0E-06
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 194 447 1.0E-06
sp|P15150|C11B1_BOVIN Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 269 435 1.0E-06
sp|Q69X58|C76M7_ORYSJ Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 185 447 1.0E-06
sp|Q9VFP1|CP6D5_DROME Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 249 440 1.0E-06
sp|P20817|CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 234 450 2.0E-06
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 269 449 2.0E-06
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 185 441 2.0E-06
sp|Q7YRB2|CP8B1_PIG 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase OS=Sus scrofa GN=CYP8B1 PE=2 SV=1 269 439 2.0E-06
sp|D5JBW8|GAO_CICIN Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 266 447 2.0E-06
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 267 450 2.0E-06
sp|Q9LTM1|C71BM_ARATH Cytochrome P450 71B22 OS=Arabidopsis thaliana GN=CYP71B22 PE=2 SV=1 228 445 2.0E-06
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 217 450 2.0E-06
sp|P30100|C11B3_RAT Cytochrome P450 11B3, mitochondrial OS=Rattus norvegicus GN=Cyp11b3 PE=1 SV=1 269 426 2.0E-06
sp|Q54DT2|C516A_DICDI Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 219 452 2.0E-06
sp|Q9LHA1|C8D11_ARATH Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 222 444 3.0E-06
sp|O04773|C75A6_CAMME Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1 212 456 3.0E-06
sp|P10614|CP51_YEAST Lanosterol 14-alpha demethylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG11 PE=1 SV=1 230 449 3.0E-06
sp|P30099|C11B2_RAT Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus GN=Cyp11b2 PE=1 SV=1 269 426 3.0E-06
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 234 450 3.0E-06
sp|D5JBX0|GAO_HELAN Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 266 447 3.0E-06
sp|Q92045|CP11A_DASAM Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 253 438 3.0E-06
sp|Q9LTM6|C71BH_ARATH Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=3 SV=1 229 447 3.0E-06
sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 206 441 3.0E-06
sp|Q9LTL2|C71BP_ARATH Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 229 444 4.0E-06
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 126 440 4.0E-06
sp|Q5IZM4|CP51_MYCVP Lanosterol 14-alpha demethylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cyp51 PE=3 SV=1 260 472 4.0E-06
sp|O48958|C71E1_SORBI 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 277 468 5.0E-06
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 275 451 9.0E-06
sp|B5BSX1|BAMO_GLYUR Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 210 438 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0046906 tetrapyrrole binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6201
MNRSEMNALESYPQGIPWSQALAALTIIGLCTWLFYPSKGNISAPLIGCCWPWKPKFLAGIRFATGAQDIISEGY
TKCKDSSFRISRTDGDVLVLSRKYLDELHNAPVKRLSSMQGLIKNFGGYYSGIHLLGESDVGTHALQTKITPNLP
KLSDDMRDEVDYALKMDMPSCHVTMTQMAMRFVPPWMRPLLDLILPSSRKYKASVRDGKKMMIPEIERRRHLEET
DPDYVKPDDLLQAMMDLSSPGEKQSQPEDLAHRQLLVTVVAGHSTAAAASHALFDMAARPECLDELRGEAVEVLR
DEGGYWGKQSLGKLAKMDSFLRESQRMNPPSLLGFHRIVQDPSGITLNDGLHIPYGTHIAIAPHSVSSDPTIINQ
PETFNALRYFERRRENTTEATRHQHVTADKDHLHFGYGTWSCPGRFLASAELKMVLVELLLRYDFRYPEGSSRPV
NRNIEEFPYVDVETPLLVRRRR*
Coding >Ophun1|6201
ATGAATCGCAGTGAGATGAATGCCCTCGAGTCGTATCCCCAGGGCATCCCCTGGTCTCAGGCGCTCGCCGCACTC
ACCATCATCGGCCTCTGCACCTGGCTCTTCTATCCCTCGAAAGGAAACATCTCAGCTCCATTGATCGGATGTTGC
TGGCCATGGAAGCCCAAGTTTCTAGCGGGCATCCGTTTCGCAACTGGCGCTCAGGACATCATCAGCGAGGGATAC
ACCAAGTGCAAGGATTCAAGCTTTCGAATCTCGCGGACTGATGGCGATGTGCTCGTTCTGTCGCGCAAGTATTTA
GATGAGCTGCACAACGCTCCTGTCAAGCGACTGAGCTCTATGCAAGGTTTGATCAAGAACTTTGGCGGCTATTAT
AGCGGAATTCACCTCCTCGGTGAAAGCGACGTCGGGACTCATGCCCTTCAGACGAAAATCACGCCCAATCTCCCC
AAGCTGTCCGACGACATGAGAGACGAGGTCGACTACGCGCTGAAAATGGATATGCCCAGTTGTCACGTGACCATG
ACGCAGATGGCCATGCGCTTCGTTCCCCCCTGGATGAGACCTCTCCTGGATCTCATCCTCCCCTCTTCCCGGAAG
TACAAAGCCAGCGTCCGTGACGGCAAGAAGATGATGATACCCGAGATCGAGCGAAGGCGTCATCTAGAGGAGACG
GATCCAGACTACGTCAAGCCCGACGACCTCCTACAAGCCATGATGGACCTCTCATCTCCGGGCGAGAAGCAGAGC
CAGCCCGAGGATCTGGCTCACCGACAACTCCTCGTGACGGTCGTCGCCGGTCACAGCACCGCTGCAGCTGCGTCT
CATGCTCTCTTTGACATGGCGGCTCGGCCTGAGTGCTTGGATGAGTTGCGTGGTGAGGCTGTTGAGGTGCTGCGA
GATGAGGGCGGTTATTGGGGGAAGCAGTCGCTGGGCAAGTTGGCCAAGATGGATAGTTTTCTACGAGAGTCTCAG
AGGATGAACCCGCCCAGTCTACTTGGCTTCCATCGCATCGTCCAGGACCCCTCTGGCATCACCCTGAACGACGGT
CTACACATCCCCTACGGAACTCACATCGCCATCGCACCGCACTCCGTCTCCAGCGACCCGACCATAATCAACCAG
CCAGAAACCTTCAACGCCCTCCGCTACTTCGAAAGACGCCGCGAAAACACCACCGAAGCCACTAGACACCAGCAC
GTAACCGCCGACAAGGACCACCTCCACTTCGGCTACGGCACCTGGTCGTGTCCCGGCCGGTTCCTGGCCTCTGCC
GAACTCAAGATGGTCCTTGTCGAGCTGCTGCTACGGTACGACTTTCGCTATCCCGAGGGAAGTTCCAGACCCGTG
AACCGCAACATCGAGGAGTTTCCGTACGTTGACGTCGAGACACCGCTGCTGGTGAGACGTCGTCGGTGA
Transcript >Ophun1|6201
ATGAATCGCAGTGAGATGAATGCCCTCGAGTCGTATCCCCAGGGCATCCCCTGGTCTCAGGCGCTCGCCGCACTC
ACCATCATCGGCCTCTGCACCTGGCTCTTCTATCCCTCGAAAGGAAACATCTCAGCTCCATTGATCGGATGTTGC
TGGCCATGGAAGCCCAAGTTTCTAGCGGGCATCCGTTTCGCAACTGGCGCTCAGGACATCATCAGCGAGGGATAC
ACCAAGTGCAAGGATTCAAGCTTTCGAATCTCGCGGACTGATGGCGATGTGCTCGTTCTGTCGCGCAAGTATTTA
GATGAGCTGCACAACGCTCCTGTCAAGCGACTGAGCTCTATGCAAGGTTTGATCAAGAACTTTGGCGGCTATTAT
AGCGGAATTCACCTCCTCGGTGAAAGCGACGTCGGGACTCATGCCCTTCAGACGAAAATCACGCCCAATCTCCCC
AAGCTGTCCGACGACATGAGAGACGAGGTCGACTACGCGCTGAAAATGGATATGCCCAGTTGTCACGTGACCATG
ACGCAGATGGCCATGCGCTTCGTTCCCCCCTGGATGAGACCTCTCCTGGATCTCATCCTCCCCTCTTCCCGGAAG
TACAAAGCCAGCGTCCGTGACGGCAAGAAGATGATGATACCCGAGATCGAGCGAAGGCGTCATCTAGAGGAGACG
GATCCAGACTACGTCAAGCCCGACGACCTCCTACAAGCCATGATGGACCTCTCATCTCCGGGCGAGAAGCAGAGC
CAGCCCGAGGATCTGGCTCACCGACAACTCCTCGTGACGGTCGTCGCCGGTCACAGCACCGCTGCAGCTGCGTCT
CATGCTCTCTTTGACATGGCGGCTCGGCCTGAGTGCTTGGATGAGTTGCGTGGTGAGGCTGTTGAGGTGCTGCGA
GATGAGGGCGGTTATTGGGGGAAGCAGTCGCTGGGCAAGTTGGCCAAGATGGATAGTTTTCTACGAGAGTCTCAG
AGGATGAACCCGCCCAGTCTACTTGGCTTCCATCGCATCGTCCAGGACCCCTCTGGCATCACCCTGAACGACGGT
CTACACATCCCCTACGGAACTCACATCGCCATCGCACCGCACTCCGTCTCCAGCGACCCGACCATAATCAACCAG
CCAGAAACCTTCAACGCCCTCCGCTACTTCGAAAGACGCCGCGAAAACACCACCGAAGCCACTAGACACCAGCAC
GTAACCGCCGACAAGGACCACCTCCACTTCGGCTACGGCACCTGGTCGTGTCCCGGCCGGTTCCTGGCCTCTGCC
GAACTCAAGATGGTCCTTGTCGAGCTGCTGCTACGGTACGACTTTCGCTATCCCGAGGGAAGTTCCAGACCCGTG
AACCGCAACATCGAGGAGTTTCCGTACGTTGACGTCGAGACACCGCTGCTGGTGAGACGTCGTCGGTGA
Gene >Ophun1|6201
ATGAATCGCAGTGAGATGAATGCCCTCGAGTCGTATCCCCAGGGCATCCCCTGGTCTCAGGCGCTCGCCGCACTC
ACCATCATCGGCCTCTGCACCTGGCTCTTCTATCCCTCGAAAGGAAACATCTCAGCTCCATTGATCGGATGTTGC
TGGCCATGGAAGCCCAAGTTTCTAGCGGGCATCCGTTTCGCAACTGGCGCTCAGGACATCATCAGCGAGGGATAC
ACCAAGGTAAGTCACTGTCCAAAACACTCCTCAGAGTACTTCTCATCGCTCATTCTCGGCAGTGCAAGGATTCAA
GCTTTCGAATCTCGCGGACTGATGGCGATGTGCTCGTTCTGTCGCGCAAGTATTTAGATGAGCTGCACAACGCTC
CTGTCAAGCGACTGAGCTCTATGCAAGGTTTGATCAAGGTTGGTTCACACTATTTGATCGATGACGAGGACTTAC
TCATCTCTCATCATTCGTGATAGAACTTTGGCGGCTATTATAGCGGAATTCACCTCCTCGGTGAAAGCGACGTCG
GGACTCATGCCCTTCAGGTTCGCAAGACGGCACCAACACTGATAAATCACAGAGCTGATATAGAAGGTGTTTCAT
TCTAGACGAAAATCACGCCCAATCTCCCCAAGCTGTCCGACGACATGAGAGACGAGGTCGACTACGCGCTGAAAA
TGGATATGCCCAGTTGTCACGGTAAAGCTGCTTCAACTCCAAGTCTCGCGGGAGTGAGATCACCGCTCAAACTGT
ATAGAATGGACAGCTGTCCCCCTTCAACCTTTGCTACTCAAGCTTCTAAGCCGCGTCACGCAACGCGTCTTTATC
GGCCTGCCCCTTTGCCGCAACCAAGACTGGCTAGACGTGTCTTCTCAGCTCGCTCACAACAGTTAGTCTCTACTT
ATTTACACTGACATGTCGGGATAATACCAGCTGAAGCTCGACAGTGACCATGACGCAGATGGCCATGCGCTTCGT
TCCCCCCTGGATGAGACCTCTCCTGGATCTCATCCTCCCCTCTTCCCGGAAGTACAAAGCCAGCGTCCGTGACGG
CAAGAAGATGATGATACCCGAGATCGAGCGAAGGCGTCATCTAGAGGAGACGGATCCAGACTACGTCAAGCCCGA
CGACCTCCTACAAGCCATGATGGACCTCTCATCTCCGGGCGAGAAGCAGAGCCAGCCCGAGGATCTGGCTCACCG
ACAACTCCTCGTGACGGTCGTCGCCGGTCACAGCACCGCTGCAGCTGCGTCTCATGCTCTCTTTGACATGGCGGC
TCGGCCTGAGTGCTTGGATGAGTTGCGTGGTGAGGCTGTTGAGGTGCTGCGAGATGAGGGCGGTTATTGGGGGAA
GCAGTCGCTGGGCAAGTTGGCCAAGATGGATAGTTTTCTACGAGAGTGAGTTGAGGAGCTGAGGGTTGTGAGTGA
TGGTCTTGTGAGTTGACAACTGACATACTGCCTTAGGTCTCAGAGGATGAACCCGCCCAGTCTACGTGAGCACAT
GTCCATCCGCAACTTCGTTCCTCTTCAACTGACAAGACATCAACTCTAGTTGGCTTCCATCGCATCGTCCAGGAC
CCCTCTGGCATCACCCTGAACGACGGTCTACACATCCCCTACGGAACTCACATCGCCATCGCACCGCACTCCGTC
TCCAGCGACCCGACCATAATCAACCAGCCAGAAACCTTCAACGCCCTCCGCTACTTCGAAAGACGCCGCGAAAAC
ACCACCGAAGCCACTAGACACCAGCACGTAACCGCCGACAAGGACCACCTCCACTTCGGCTACGGCACCTGGTCG
TGTCCCGGCCGGTTCCTGGCCTCTGCCGAACTCAAGATGGTCCTTGTCGAGCTGCTGCTACGGTACGACTTTCGC
TATCCCGAGGGAAGTTCCAGACCCGTGAACCGCAACATCGAGGAGTTTCCGTACGTTGACGTCGAGACACCGCTG
CTGGTGAGACGTCGTCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail