Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|62
Gene name
LocationContig_10:10683..11792
Strand-
Gene length (bp)1109
Transcript length (bp)1065
Coding sequence length (bp)1065
Protein length (aa) 355

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00348 polyprenyl_synt Polyprenyl synthetase 1.6E-73 48 306

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92235|FPPS_GIBFU Farnesyl pyrophosphate synthase OS=Gibberella fujikuroi GN=FPPS PE=3 SV=1 5 354 4.0E-145
sp|Q92250|FPPS_NEUCR Farnesyl pyrophosphate synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fpp PE=3 SV=2 5 354 3.0E-142
sp|O14230|FPPS_SCHPO Farnesyl pyrophosphate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fps1 PE=1 SV=1 6 354 4.0E-109
sp|P08524|FPPS_YEAST Farnesyl pyrophosphate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG20 PE=1 SV=2 4 354 1.0E-105
sp|P49349|FPPS_KLULA Farnesyl pyrophosphate synthase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FPS1 PE=3 SV=1 5 354 6.0E-100
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92235|FPPS_GIBFU Farnesyl pyrophosphate synthase OS=Gibberella fujikuroi GN=FPPS PE=3 SV=1 5 354 4.0E-145
sp|Q92250|FPPS_NEUCR Farnesyl pyrophosphate synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fpp PE=3 SV=2 5 354 3.0E-142
sp|O14230|FPPS_SCHPO Farnesyl pyrophosphate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fps1 PE=1 SV=1 6 354 4.0E-109
sp|P08524|FPPS_YEAST Farnesyl pyrophosphate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG20 PE=1 SV=2 4 354 1.0E-105
sp|P49349|FPPS_KLULA Farnesyl pyrophosphate synthase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FPS1 PE=3 SV=1 5 354 6.0E-100
sp|P08836|FPPS_CHICK Farnesyl pyrophosphate synthase OS=Gallus gallus GN=FDPS PE=1 SV=2 6 354 2.0E-85
sp|Q920E5|FPPS_MOUSE Farnesyl pyrophosphate synthase OS=Mus musculus GN=Fdps PE=1 SV=1 50 354 1.0E-81
sp|P05369|FPPS_RAT Farnesyl pyrophosphate synthase OS=Rattus norvegicus GN=Fdps PE=2 SV=2 50 354 6.0E-81
sp|Q8WMY2|FPPS_BOVIN Farnesyl pyrophosphate synthase OS=Bos taurus GN=FDPS PE=1 SV=1 50 354 6.0E-81
sp|P14324|FPPS_HUMAN Farnesyl pyrophosphate synthase OS=Homo sapiens GN=FDPS PE=1 SV=4 50 354 1.0E-77
sp|P49352|FPPS2_LUPAL Farnesyl pyrophosphate synthase 2 OS=Lupinus albus GN=FPS2 PE=2 SV=1 50 354 2.0E-75
sp|O24241|FPPS1_PARAR Farnesyl pyrophosphate synthase 1 OS=Parthenium argentatum GN=FPS1 PE=2 SV=1 48 354 2.0E-74
sp|P49351|FPPS1_LUPAL Farnesyl pyrophosphate synthase 1 OS=Lupinus albus GN=FPS1 PE=2 SV=1 6 354 3.0E-74
sp|O24242|FPPS2_PARAR Farnesyl pyrophosphate synthase 2 OS=Parthenium argentatum GN=FPS2 PE=2 SV=1 48 354 7.0E-73
sp|Q9NH03|FPS_DICDI Farnesyl diphosphate synthase OS=Dictyostelium discoideum GN=fps PE=2 SV=1 48 352 3.0E-72
sp|Q7XYS9|FPPS1_ARTSI Farnesyl diphosphate synthase 1 OS=Artemisia spiciformis GN=FDS-1 PE=1 SV=1 48 354 7.0E-72
sp|O59703|GGPPS_SCHPO Geranylgeranyl pyrophosphate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spo9 PE=1 SV=1 49 354 8.0E-72
sp|P49353|FPPS_MAIZE Farnesyl pyrophosphate synthase OS=Zea mays GN=FPS PE=2 SV=1 50 354 8.0E-72
sp|Q43315|FPPS2_ARATH Farnesyl pyrophosphate synthase 2 OS=Arabidopsis thaliana GN=FPS2 PE=2 SV=1 50 354 2.0E-71
sp|P49350|FPPS_ARTAN Farnesyl pyrophosphate synthase OS=Artemisia annua GN=FPS1 PE=2 SV=1 48 354 3.0E-71
sp|Q7XYT0|FPPS2_ARTSI Farnesyl diphosphate synthase 2 OS=Artemisia spiciformis GN=FDS-2 PE=1 SV=1 1 354 5.0E-71
sp|Q09152|FPPS1_ARATH Farnesyl pyrophosphate synthase 1, mitochondrial OS=Arabidopsis thaliana GN=FPS1 PE=2 SV=2 50 354 2.0E-70
sp|O64905|FPPS_HELAN Farnesyl pyrophosphate synthase OS=Helianthus annuus GN=FPS1 PE=2 SV=1 48 354 3.0E-70
sp|Q54XP1|Y8823_DICDI Probable farnesyl diphosphate synthase DDB_G0278823 OS=Dictyostelium discoideum GN=DDB_G0278823 PE=3 SV=1 50 354 1.0E-68
sp|P0C565|CPPAS_TANCI Chrysanthemyl diphosphate synthase, chloroplastic OS=Tanacetum cinerariifolium PE=1 SV=1 8 354 3.0E-61
sp|Q7XYS8|CHRDS_ARTSI Monoterpene synthase FDS-5, chloroplastic OS=Artemisia spiciformis GN=FDS-5 PE=1 SV=1 50 325 3.0E-56
sp|Q55EU7|Y8742_DICDI Probable farnesyl diphosphate synthase DDB_G0268742 OS=Dictyostelium discoideum GN=DDB_G0268742 PE=3 SV=1 6 331 1.0E-46
sp|O26156|IDSA_METTH Short chain isoprenyl diphosphate synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=idsA PE=3 SV=1 57 294 4.0E-11
sp|Q58270|IDSA_METJA Short chain isoprenyl diphosphate synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=idsA PE=3 SV=1 77 297 7.0E-11
sp|Q53479|IDSA_METTM Short chain isoprenyl diphosphate synthase OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=idsA PE=1 SV=3 57 294 8.0E-10
sp|P95999|GGPS_SULSO Geranylgeranyl diphosphate synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gds PE=3 SV=2 57 297 3.0E-09
sp|P39464|GGPS_SULAC Geranylgeranyl diphosphate synthase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=gds PE=1 SV=1 89 331 7.0E-09
sp|Q9UWR6|GFPS_AERPX Geranylfarnesyl diphosphate synthase OS=Aeropyrum pernix GN=fgs PE=1 SV=1 88 354 1.0E-08
sp|P0AD58|ISPB_SHIFL Octaprenyl-diphosphate synthase OS=Shigella flexneri GN=ispB PE=3 SV=1 85 324 1.0E-07
sp|P0AD57|ISPB_ECOLI Octaprenyl-diphosphate synthase OS=Escherichia coli (strain K12) GN=ispB PE=1 SV=1 85 324 1.0E-07
sp|Q12051|GGPPS_YEAST Geranylgeranyl pyrophosphate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BTS1 PE=1 SV=1 84 280 5.0E-07
sp|B2DBE9|GGS4_PHOAM Geranylgeranyl pyrophosphate synthase D OS=Phomopsis amygdali GN=GGS-D PE=1 SV=1 92 334 1.0E-06
sp|P24322|GGPPS_NEUCR Geranylgeranyl pyrophosphate synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=al-3 PE=2 SV=2 92 341 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008299 isoprenoid biosynthetic process Yes
GO:0006720 isoprenoid metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|62
MTLLTRPRFEAVFPRLVSAVLDHARSFKLDQSELDRFKQSLTSSPHTKNIEFNCLDGKFNRALSVLEAVSLLQGK
PLDDSQFTQVAALGWALELLHISMLMFDDVMDKGINRRGKPCWYRVQGVGLNAINDSMMLQSSAFFLLKDIFRSH
PLYTEILEALLEAQFKTEMGQHIDLLTAPQDQTNLDKFTADKYTLIAVTKTAYSFFLPVALALYYLELATPNNIK
QTEEIVPLLTEYFQIQDDYLDNFGRPETIGKIGNDIRENKCSWLVVQALEIATPKQRRVLEENYGRDDDVKERAV
KKLYDELALEQRYQEFEEQRVKEIRDMINRVDESEGLKKGVFSAMLSQIYKRSK*
Coding >Ophun1|62
ATGACTTTGCTCACTCGACCGAGGTTCGAGGCCGTCTTTCCCCGGCTCGTGTCGGCTGTTCTTGACCACGCAAGG
TCGTTCAAACTCGATCAGTCAGAGTTGGACAGGTTCAAGCAAAGTCTCACCTCGAGTCCCCACACCAAGAACATC
GAGTTCAACTGCCTCGATGGCAAGTTCAACAGGGCGCTCTCTGTCCTAGAGGCAGTGTCCCTGCTTCAGGGGAAG
CCCCTGGATGATTCACAGTTTACCCAAGTCGCTGCCCTCGGATGGGCCCTAGAGCTCCTCCACATCTCTATGCTC
ATGTTCGACGACGTAATGGACAAGGGCATAAACCGTCGCGGCAAGCCCTGCTGGTACCGCGTTCAGGGCGTTGGC
TTGAATGCCATCAACGATTCCATGATGCTACAGTCGTCCGCCTTCTTCCTCTTGAAAGACATCTTTCGGTCTCAC
CCTCTGTATACGGAAATCTTGGAGGCATTGCTAGAAGCGCAGTTCAAGACAGAGATGGGCCAGCATATTGATCTA
CTTACTGCTCCCCAAGACCAGACGAATCTCGACAAGTTCACCGCTGACAAGTACACCCTGATCGCCGTCACGAAG
ACGGCATACTCTTTCTTCCTCCCGGTTGCTTTGGCTCTGTATTACCTGGAACTTGCAACGCCCAACAATATTAAG
CAGACGGAAGAGATTGTGCCATTACTCACCGAGTATTTCCAAATTCAAGACGACTATCTCGACAACTTTGGCCGG
CCCGAGACTATCGGCAAGATCGGGAACGACATTCGGGAGAATAAGTGTTCCTGGCTCGTTGTGCAGGCTCTAGAG
ATAGCCACACCGAAGCAGCGCAGAGTCCTTGAAGAGAATTACGGCCGGGACGACGACGTAAAAGAGAGGGCGGTC
AAGAAGCTTTACGACGAGCTGGCGCTGGAGCAGCGGTACCAGGAGTTTGAAGAGCAGCGGGTCAAGGAGATTCGG
GACATGATTAACAGGGTCGACGAGAGCGAGGGACTCAAGAAGGGCGTCTTTTCAGCCATGCTTTCTCAGATCTAC
AAGCGTAGCAAATGA
Transcript >Ophun1|62
ATGACTTTGCTCACTCGACCGAGGTTCGAGGCCGTCTTTCCCCGGCTCGTGTCGGCTGTTCTTGACCACGCAAGG
TCGTTCAAACTCGATCAGTCAGAGTTGGACAGGTTCAAGCAAAGTCTCACCTCGAGTCCCCACACCAAGAACATC
GAGTTCAACTGCCTCGATGGCAAGTTCAACAGGGCGCTCTCTGTCCTAGAGGCAGTGTCCCTGCTTCAGGGGAAG
CCCCTGGATGATTCACAGTTTACCCAAGTCGCTGCCCTCGGATGGGCCCTAGAGCTCCTCCACATCTCTATGCTC
ATGTTCGACGACGTAATGGACAAGGGCATAAACCGTCGCGGCAAGCCCTGCTGGTACCGCGTTCAGGGCGTTGGC
TTGAATGCCATCAACGATTCCATGATGCTACAGTCGTCCGCCTTCTTCCTCTTGAAAGACATCTTTCGGTCTCAC
CCTCTGTATACGGAAATCTTGGAGGCATTGCTAGAAGCGCAGTTCAAGACAGAGATGGGCCAGCATATTGATCTA
CTTACTGCTCCCCAAGACCAGACGAATCTCGACAAGTTCACCGCTGACAAGTACACCCTGATCGCCGTCACGAAG
ACGGCATACTCTTTCTTCCTCCCGGTTGCTTTGGCTCTGTATTACCTGGAACTTGCAACGCCCAACAATATTAAG
CAGACGGAAGAGATTGTGCCATTACTCACCGAGTATTTCCAAATTCAAGACGACTATCTCGACAACTTTGGCCGG
CCCGAGACTATCGGCAAGATCGGGAACGACATTCGGGAGAATAAGTGTTCCTGGCTCGTTGTGCAGGCTCTAGAG
ATAGCCACACCGAAGCAGCGCAGAGTCCTTGAAGAGAATTACGGCCGGGACGACGACGTAAAAGAGAGGGCGGTC
AAGAAGCTTTACGACGAGCTGGCGCTGGAGCAGCGGTACCAGGAGTTTGAAGAGCAGCGGGTCAAGGAGATTCGG
GACATGATTAACAGGGTCGACGAGAGCGAGGGACTCAAGAAGGGCGTCTTTTCAGCCATGCTTTCTCAGATCTAC
AAGCGTAGCAAATGA
Gene >Ophun1|62
ATGACTTTGCTCACTCGACCGAGGTTCGAGGCCGTCTTTCCCCGGCTCGTGTCGGCTGTTCTTGACCACGCAAGG
TCGTTCAAACTCGATCAGTCAGAGTTGGACAGGTTCAAGCAAGTCAGTTCAATTCATTCTTTGATCCCAAGACGC
ATATCTATCAGAGTCTCACCTCGAGTCCCCACACCAAGAACATCGAGTTCAACTGCCTCGATGGCAAGTTCAACA
GGGCGCTCTCTGTCCTAGAGGCAGTGTCCCTGCTTCAGGGGAAGCCCCTGGATGATTCACAGTTTACCCAAGTCG
CTGCCCTCGGATGGGCCCTAGAGCTCCTCCACATCTCTATGCTCATGTTCGACGACGTAATGGACAAGGGCATAA
ACCGTCGCGGCAAGCCCTGCTGGTACCGCGTTCAGGGCGTTGGCTTGAATGCCATCAACGATTCCATGATGCTAC
AGTCGTCCGCCTTCTTCCTCTTGAAAGACATCTTTCGGTCTCACCCTCTGTATACGGAAATCTTGGAGGCATTGC
TAGAAGCGCAGTTCAAGACAGAGATGGGCCAGCATATTGATCTACTTACTGCTCCCCAAGACCAGACGAATCTCG
ACAAGTTCACCGCTGACAAGTACACCCTGATCGCCGTCACGAAGACGGCATACTCTTTCTTCCTCCCGGTTGCTT
TGGCTCTGTATTACCTGGAACTTGCAACGCCCAACAATATTAAGCAGACGGAAGAGATTGTGCCATTACTCACCG
AGTATTTCCAAATTCAAGACGACTATCTCGACAACTTTGGCCGGCCCGAGACTATCGGCAAGATCGGGAACGACA
TTCGGGAGAATAAGTGTTCCTGGCTCGTTGTGCAGGCTCTAGAGATAGCCACACCGAAGCAGCGCAGAGTCCTTG
AAGAGAATTACGGCCGGGACGACGACGTAAAAGAGAGGGCGGTCAAGAAGCTTTACGACGAGCTGGCGCTGGAGC
AGCGGTACCAGGAGTTTGAAGAGCAGCGGGTCAAGGAGATTCGGGACATGATTAACAGGGTCGACGAGAGCGAGG
GACTCAAGAAGGGCGTCTTTTCAGCCATGCTTTCTCAGATCTACAAGCGTAGCAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail