Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6199
Gene name
LocationContig_66:31196..32960
Strand+
Gene length (bp)1764
Transcript length (bp)1530
Coding sequence length (bp)1530
Protein length (aa) 510

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 2.7E-37 180 481

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94142|KO1_GIBFU Ent-kaurene oxidase OS=Gibberella fujikuroi GN=CYP503A1 PE=1 SV=1 33 507 3.0E-64
sp|Q701P2|KO1_GIBIN Ent-kaurene oxidase OS=Gibberella intermedia GN=CYP503A1 PE=1 SV=1 33 507 2.0E-63
sp|Q9Y7C8|LOVA_ASPTE Dihydromonacolin L monooxygenase LovA OS=Aspergillus terreus GN=lovA PE=1 SV=1 174 479 3.0E-24
sp|B9WZX6|FTMG_ASPFM Fumitremorgin C monooxygenase OS=Neosartorya fumigata GN=ftmP450-3 PE=1 SV=1 36 475 3.0E-21
sp|Q4WAX0|FTMG_ASPFU Fumitremorgin C monooxygenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-3 PE=3 SV=1 36 475 4.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94142|KO1_GIBFU Ent-kaurene oxidase OS=Gibberella fujikuroi GN=CYP503A1 PE=1 SV=1 33 507 3.0E-64
sp|Q701P2|KO1_GIBIN Ent-kaurene oxidase OS=Gibberella intermedia GN=CYP503A1 PE=1 SV=1 33 507 2.0E-63
sp|Q9Y7C8|LOVA_ASPTE Dihydromonacolin L monooxygenase LovA OS=Aspergillus terreus GN=lovA PE=1 SV=1 174 479 3.0E-24
sp|B9WZX6|FTMG_ASPFM Fumitremorgin C monooxygenase OS=Neosartorya fumigata GN=ftmP450-3 PE=1 SV=1 36 475 3.0E-21
sp|Q4WAX0|FTMG_ASPFU Fumitremorgin C monooxygenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-3 PE=3 SV=1 36 475 4.0E-21
sp|A1DA65|FTMG_NEOFI Fumitremorgin C monooxygenase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-3 PE=3 SV=1 36 475 1.0E-20
sp|O46420|CP51A_PIG Lanosterol 14-alpha demethylase OS=Sus scrofa GN=CYP51A1 PE=2 SV=1 262 476 6.0E-17
sp|Q4PJW3|CP51A_BOVIN Lanosterol 14-alpha demethylase OS=Bos taurus GN=CYP51A1 PE=2 SV=1 265 476 1.0E-16
sp|Q4R8S6|CP51A_MACFA Lanosterol 14-alpha demethylase OS=Macaca fascicularis GN=CYP51A1 PE=2 SV=2 262 476 2.0E-16
sp|Q5RE72|CP51A_PONAB Lanosterol 14-alpha demethylase OS=Pongo abelii GN=CYP51A1 PE=2 SV=2 262 476 2.0E-16
sp|Q16850|CP51A_HUMAN Lanosterol 14-alpha demethylase OS=Homo sapiens GN=CYP51A1 PE=1 SV=3 262 476 6.0E-16
sp|Q9UVC3|CP51_CUNEL Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 263 478 8.0E-16
sp|Q64654|CP51A_RAT Lanosterol 14-alpha demethylase OS=Rattus norvegicus GN=Cyp51a1 PE=2 SV=1 262 476 6.0E-15
sp|Q8K0C4|CP51A_MOUSE Lanosterol 14-alpha demethylase OS=Mus musculus GN=Cyp51a1 PE=1 SV=1 255 476 6.0E-15
sp|Q759W0|CP51_ASHGO Lanosterol 14-alpha demethylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG11 PE=3 SV=1 263 466 6.0E-15
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 304 474 1.0E-13
sp|P10614|CP51_YEAST Lanosterol 14-alpha demethylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG11 PE=1 SV=1 263 508 2.0E-13
sp|Q9FH76|ABAH3_ARATH Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thaliana GN=CYP707A3 PE=1 SV=1 236 485 7.0E-13
sp|Q02318|CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 304 476 8.0E-13
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 304 474 1.0E-12
sp|Q07973|CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 304 507 2.0E-12
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 304 507 3.0E-12
sp|Q6XQ14|C71E7_MANES 2-methylbutanal oxime monooxygenase OS=Manihot esculenta GN=CYP71E7 PE=1 SV=1 180 507 3.0E-12
sp|Q9VQD2|CP391_DROME Probable cytochrome P450 309a1 OS=Drosophila melanogaster GN=Cyp309a1 PE=1 SV=4 209 500 4.0E-12
sp|P50859|CP51_CANGA Lanosterol 14-alpha demethylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG11 PE=3 SV=1 263 507 1.0E-11
sp|P51663|C11B1_SHEEP Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 304 476 1.0E-11
sp|Q9V8M2|C12B2_DROME Probable cytochrome P450 12b2, mitochondrial OS=Drosophila melanogaster GN=Cyp12b2 PE=2 SV=2 306 474 1.0E-11
sp|Q9C5Y2|KAO2_ARATH Ent-kaurenoic acid oxidase 2 OS=Arabidopsis thaliana GN=KAO2 PE=2 SV=2 209 485 2.0E-11
sp|Q9VMT5|C28D1_DROME Probable cytochrome P450 28d1 OS=Drosophila melanogaster GN=Cyp28d1 PE=2 SV=1 248 476 2.0E-11
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 267 474 2.0E-11
sp|Q7X7X4|C99A2_ORYSJ Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2 310 476 2.0E-11
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 249 475 3.0E-11
sp|P15150|C11B1_BOVIN Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 304 476 3.0E-11
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 304 476 5.0E-11
sp|Q29552|C11B1_PIG Cytochrome P450 11B1, mitochondrial OS=Sus scrofa GN=CYP11B1 PE=2 SV=1 304 476 5.0E-11
sp|Q09736|CP51_SCHPO Lanosterol 14-alpha demethylase erg11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg11 PE=1 SV=1 304 478 6.0E-11
sp|Q1ZXH9|CP51_DICDI Probable lanosterol 14-alpha demethylase OS=Dictyostelium discoideum GN=cyp51 PE=3 SV=1 13 476 6.0E-11
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 221 476 6.0E-11
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 264 476 6.0E-11
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 258 475 7.0E-11
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 304 476 8.0E-11
sp|Q949P1|ABAH1_ARATH Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thaliana GN=CYP707A1 PE=2 SV=1 236 485 2.0E-10
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 252 479 3.0E-10
sp|Q9VFP1|CP6D5_DROME Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 239 482 4.0E-10
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 249 502 4.0E-10
sp|E3W9C4|C71A1_ZINZE Alpha-humulene 10-hydroxylase OS=Zingiber zerumbet GN=CYP71BA1 PE=1 SV=1 179 496 4.0E-10
sp|P14263|CP51_CANTR Lanosterol 14-alpha demethylase OS=Candida tropicalis GN=ERG11 PE=3 SV=2 294 509 4.0E-10
sp|Q9VMT6|C28D2_DROME Probable cytochrome P450 28d2 OS=Drosophila melanogaster GN=Cyp28d2 PE=3 SV=1 263 477 5.0E-10
sp|P0DKI7|STORR_PAPSO Bifunctional protein STORR OS=Papaver somniferum GN=STORR PE=1 SV=1 137 507 6.0E-10
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 255 475 9.0E-10
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 249 475 9.0E-10
sp|P15393|C11B1_RAT Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 309 457 1.0E-09
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 249 475 1.0E-09
sp|Q9AXH9|KAO1_HORVU Ent-kaurenoic acid oxidase 1 OS=Hordeum vulgare GN=KAO1 PE=1 SV=1 310 484 1.0E-09
sp|Q64408|C11B1_CAVPO Cytochrome P450 11B1, mitochondrial OS=Cavia porcellus GN=CYP11B1 PE=2 SV=1 309 476 1.0E-09
sp|P15539|C11B2_MOUSE Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 304 475 1.0E-09
sp|O23051|KAO1_ARATH Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana GN=KAO1 PE=2 SV=1 240 485 2.0E-09
sp|Q9VFJ0|CA131_DROME Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2 166 474 2.0E-09
sp|Q54NY3|C554A_DICDI Probable cytochrome P450 554A1 OS=Dictyostelium discoideum GN=cyp554A1 PE=3 SV=1 219 505 2.0E-09
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 306 476 3.0E-09
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 276 472 3.0E-09
sp|P30100|C11B3_RAT Cytochrome P450 11B3, mitochondrial OS=Rattus norvegicus GN=Cyp11b3 PE=1 SV=1 304 457 3.0E-09
sp|P37124|C77A2_SOLME Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1 311 473 3.0E-09
sp|O44220|C12B1_DROAC Cytochrome P450 12b1, mitochondrial OS=Drosophila acanthoptera GN=Cyp12b1 PE=2 SV=1 306 489 4.0E-09
sp|P30099|C11B2_RAT Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus GN=Cyp11b2 PE=1 SV=1 304 457 4.0E-09
sp|Q9V6D6|CP301_DROME Probable cytochrome P450 301a1, mitochondrial OS=Drosophila melanogaster GN=Cyp301a1 PE=2 SV=1 304 475 4.0E-09
sp|P17177|CP27A_RABIT Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 304 476 4.0E-09
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 261 475 5.0E-09
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 249 475 5.0E-09
sp|Q9V419|C28A5_DROME Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 258 491 7.0E-09
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 258 478 7.0E-09
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 255 509 7.0E-09
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 239 482 8.0E-09
sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 253 479 9.0E-09
sp|Q9LVD2|C71BA_ARATH Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 94 476 1.0E-08
sp|P19099|C11B2_HUMAN Cytochrome P450 11B2, mitochondrial OS=Homo sapiens GN=CYP11B2 PE=1 SV=3 304 454 1.0E-08
sp|Q09660|CC44_CAEEL Probable cytochrome P450 CYP44 OS=Caenorhabditis elegans GN=cyp-44A1 PE=3 SV=2 233 479 1.0E-08
sp|Q7XU38|C87A3_ORYSJ Cytochrome P450 87A3 OS=Oryza sativa subsp. japonica GN=CYP87A3 PE=2 SV=3 215 488 1.0E-08
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 239 482 1.0E-08
sp|Q29527|C11B1_PAPHU Cytochrome P450 11B1, mitochondrial OS=Papio hamadryas ursinus GN=CYP11B1 PE=3 SV=1 290 454 1.0E-08
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 264 475 2.0E-08
sp|Q9VE00|C12A4_DROME Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 306 476 2.0E-08
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 276 476 2.0E-08
sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 179 476 2.0E-08
sp|Q64658|C11B2_MESAU Cytochrome P450 11B2, mitochondrial OS=Mesocricetus auratus GN=CYP11B2 PE=2 SV=1 304 477 2.0E-08
sp|F8S1H3|C7BL1_HELAN Cytochrome P450 71BL1 OS=Helianthus annuus GN=CYP71BL1 PE=2 SV=1 168 496 3.0E-08
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 276 475 3.0E-08
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 263 475 3.0E-08
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 249 475 4.0E-08
sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 215 476 4.0E-08
sp|B5BSX1|BAMO_GLYUR Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 292 482 4.0E-08
sp|Q43246|C88A1_MAIZE Cytochrome P450 88A1 OS=Zea mays GN=CYP88A1 PE=2 SV=1 310 484 4.0E-08
sp|P10613|CP51_CANAL Lanosterol 14-alpha demethylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG11 PE=3 SV=2 262 509 5.0E-08
sp|Q9VGZ0|C12E1_DROME Probable cytochrome P450 12e1, mitochondrial OS=Drosophila melanogaster GN=Cyp12e1 PE=2 SV=4 304 474 6.0E-08
sp|Q59990|CP120_SYNY3 Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 116 476 6.0E-08
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 249 475 6.0E-08
sp|P15538|C11B1_HUMAN Cytochrome P450 11B1, mitochondrial OS=Homo sapiens GN=CYP11B1 PE=1 SV=5 290 454 6.0E-08
sp|Q9SAA9|CP511_ARATH Sterol 14-demethylase OS=Arabidopsis thaliana GN=CYP51G1 PE=1 SV=1 248 476 7.0E-08
sp|Q92104|CP11B_LITCT Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 309 505 8.0E-08
sp|F2Z9C1|P6H_ESCCA Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 220 474 8.0E-08
sp|Q9LTM3|C71BK_ARATH Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1 214 483 8.0E-08
sp|Q0DS59|C14B2_ORYSJ Cytochrome P450 714B2 OS=Oryza sativa subsp. japonica GN=CYP714B2 PE=1 SV=2 304 476 9.0E-08
sp|Q54QD2|C5171_DICDI Probable cytochrome P450 517A1 OS=Dictyostelium discoideum GN=cyp517A1 PE=2 SV=1 268 477 1.0E-07
sp|Q6QNI4|C71AJ_AMMMJ Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 273 476 1.0E-07
sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 306 476 1.0E-07
sp|O88962|CP8B1_MOUSE 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase OS=Mus musculus GN=Cyp8b1 PE=1 SV=1 251 476 1.0E-07
sp|Q12664|CP51_PENIT Eburicol 14-alpha-demethylase OS=Penicillium italicum GN=CYP51 PE=3 SV=1 294 472 1.0E-07
sp|Q95M61|CP19A_CALJA Aromatase OS=Callithrix jacchus GN=CYP19A1 PE=2 SV=2 234 481 1.0E-07
sp|Q43147|C85A1_SOLLC Cytochrome P450 85A1 OS=Solanum lycopersicum GN=CYP85A1 PE=2 SV=1 255 485 1.0E-07
sp|Q09653|C13AA_CAEEL Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 268 476 1.0E-07
sp|O93323|CP26A_XENLA Cytochrome P450 26A1 OS=Xenopus laevis GN=cyp26a1 PE=2 SV=1 177 476 1.0E-07
sp|Q27756|CP6B3_PAPPO Cytochrome P450 6B3 OS=Papilio polyxenes GN=CYP6B3 PE=2 SV=1 279 475 1.0E-07
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 262 475 1.0E-07
sp|P97720|C11B1_MESAU Cytochrome P450 11B1, mitochondrial OS=Mesocricetus auratus GN=CYP11B1 PE=2 SV=1 304 477 1.0E-07
sp|Q54QD0|C5174_DICDI Probable cytochrome P450 517A4 OS=Dictyostelium discoideum GN=cyp517A4 PE=3 SV=1 268 477 1.0E-07
sp|Q6YTF1|C76M8_ORYSJ Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 255 478 2.0E-07
sp|O48928|C77A3_SOYBN Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 311 473 2.0E-07
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 249 474 2.0E-07
sp|O65788|C71B2_ARATH Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 253 473 3.0E-07
sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 322 508 3.0E-07
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 294 474 3.0E-07
sp|Q964T2|CP9E2_BLAGE Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 315 476 4.0E-07
sp|O42145|C19AA_DANRE Aromatase OS=Danio rerio GN=cyp19a1a PE=2 SV=1 173 474 4.0E-07
sp|O22307|C71DB_LOTJA Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 306 476 4.0E-07
sp|Q54DT2|C516A_DICDI Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 245 477 4.0E-07
sp|Q92087|CP19A_ORYLA Aromatase OS=Oryzias latipes GN=cyp19a1 PE=2 SV=1 186 474 4.0E-07
sp|P58048|C71B8_ARATH Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 322 476 4.0E-07
sp|O17624|C13B1_CAEEL Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 303 474 4.0E-07
sp|Q27520|C13A1_CAEEL Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 303 465 4.0E-07
sp|L7X3S1|MSH_PAPSO Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 276 474 4.0E-07
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 311 476 4.0E-07
sp|Q9VYT8|C28C1_DROME Probable cytochrome P450 28c1 OS=Drosophila melanogaster GN=Cyp28c1 PE=2 SV=1 262 453 4.0E-07
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 276 475 4.0E-07
sp|Q9LSF8|C82G1_ARATH Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 296 474 5.0E-07
sp|P49602|CP51_USTMA Lanosterol 14-alpha demethylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG11 PE=3 SV=1 296 469 5.0E-07
sp|Q9V4I1|CP9B2_DROME Cytochrome P450 9b2 OS=Drosophila melanogaster GN=Cyp9b2 PE=2 SV=1 251 475 5.0E-07
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 241 474 5.0E-07
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 311 509 5.0E-07
sp|O46491|CP7A1_PIG Cholesterol 7-alpha-monooxygenase OS=Sus scrofa GN=CYP7A1 PE=3 SV=1 176 476 6.0E-07
sp|P37123|C77A1_SOLME Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 311 473 6.0E-07
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 287 479 7.0E-07
sp|O14442|CP51_UNCNE Eburicol 14-alpha-demethylase OS=Uncinula necator GN=CYP51 PE=2 SV=2 271 469 7.0E-07
sp|Q9LJY7|C75AK_ARATH Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 249 479 7.0E-07
sp|P14779|CPXB_BACME Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 259 475 8.0E-07
sp|Q69X58|C76M7_ORYSJ Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 255 478 8.0E-07
sp|D5JBX0|GAO_HELAN Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 174 482 8.0E-07
sp|Q5IZM4|CP51_MYCVP Lanosterol 14-alpha demethylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cyp51 PE=3 SV=1 270 476 9.0E-07
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 294 475 9.0E-07
sp|Q27518|C13A2_CAEEL Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 311 507 1.0E-06
sp|Q93ZB2|KO1_ARATH Ent-kaurene oxidase, chloroplastic OS=Arabidopsis thaliana GN=KO PE=1 SV=2 249 480 1.0E-06
sp|Q04552|CP6B1_PAPPO Cytochrome P450 6B1 OS=Papilio polyxenes GN=CYP6B1 PE=1 SV=1 303 475 1.0E-06
sp|D5J9U8|GAO_LACSA Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 322 482 1.0E-06
sp|D5JBW8|GAO_CICIN Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 322 482 1.0E-06
sp|Q7YRB2|CP8B1_PIG 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase OS=Sus scrofa GN=CYP8B1 PE=2 SV=1 320 476 1.0E-06
sp|P93596|CP51_WHEAT Obtusifoliol 14-alpha demethylase (Fragment) OS=Triticum aestivum GN=CYP51 PE=2 SV=1 263 476 1.0E-06
sp|Q27902|CP6B4_PAPGL Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 PE=2 SV=1 296 472 2.0E-06
sp|D5JBW9|GAO_SAUCO Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 322 482 2.0E-06
sp|Q95036|CP6B5_PAPGL Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus GN=CYP6B5 PE=2 SV=1 296 472 2.0E-06
sp|P48416|CP10_LYMST Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 304 479 2.0E-06
sp|Q9LW27|C71BF_ARATH Bifunctional dihydrocamalexate synthase/camalexin synthase OS=Arabidopsis thaliana GN=CYP71B15 PE=1 SV=1 171 493 2.0E-06
sp|L7X0L7|P6H_PAPSO Protopine 6-monooxygenase OS=Papaver somniferum GN=CYP82N3 PE=2 SV=1 266 479 2.0E-06
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 303 475 2.0E-06
sp|Q9VE01|C12A5_DROME Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 306 477 2.0E-06
sp|Q8N118|CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 270 474 2.0E-06
sp|D5JBX1|GAO_BARSP Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 322 476 2.0E-06
sp|Q1PS23|AMO_ARTAN Amorpha-4,11-diene 12-monooxygenase OS=Artemisia annua GN=CYP71AV1 PE=1 SV=1 303 494 2.0E-06
sp|P33270|CP6A2_DROME Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 250 457 2.0E-06
sp|O81973|C93A3_SOYBN Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 294 479 2.0E-06
sp|E1B2Z9|C7AV8_CICIN Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 322 476 3.0E-06
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 276 475 3.0E-06
sp|O08336|CYPB_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 229 474 3.0E-06
sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 311 476 3.0E-06
sp|O02766|CP8B1_RABIT 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase OS=Oryctolagus cuniculus GN=CYP8B1 PE=1 SV=3 311 476 3.0E-06
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 281 478 3.0E-06
sp|Q9PUB4|CP26A_CHICK Cytochrome P450 26A1 OS=Gallus gallus GN=CYP26A1 PE=2 SV=1 267 496 3.0E-06
sp|B6SSW8|C14B3_MAIZE Cytochrome P450 714B3 OS=Zea mays GN=CYP714B3 PE=2 SV=1 311 476 4.0E-06
sp|P22680|CP7A1_HUMAN Cholesterol 7-alpha-monooxygenase OS=Homo sapiens GN=CYP7A1 PE=1 SV=2 320 486 4.0E-06
sp|Q43250|C71C1_MAIZE 3-hydroxyindolin-2-one monooxygenase OS=Zea mays GN=CYP71C1 PE=1 SV=1 210 479 4.0E-06
sp|P00189|CP11A_BOVIN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus GN=CYP11A1 PE=1 SV=1 309 480 5.0E-06
sp|Q9LTM0|C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 302 476 6.0E-06
sp|P29980|CPXN_NOSS1 Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 251 488 6.0E-06
sp|Q9LTM4|C71BJ_ARATH Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=CYP71B19 PE=2 SV=1 214 483 6.0E-06
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 255 475 7.0E-06
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 301 475 7.0E-06
sp|O73686|CP192_CARAU Ovarian aromatase OS=Carassius auratus GN=cyp19a2 PE=2 SV=1 172 474 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0046906 tetrapyrrole binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6199
MPSSILLVQAPIACALLLGLLLVELSRRRKGSKIPTIRRWPAPFPEILDRLSYNRNAVALVREGYTKHKNVPFRL
LKMDMDLVVIPLKYAAELRAVTSDKLDPLTASFDDNAGHLTKILLGSELHSDAIHRPRIIPVVVDELKFAFDHVL
AQGSKSGKSNSLIINQTTYPLYLTDSWTAVNPYDMVLDLSTRAAARIFVGEPICRDEQFLQTTASYSRNSFSTID
TFRNLGSIIGLFGRAMSSTVTDARDQLAYVQRLLGDEVTRRRARPDDKHDDFLQWCMDLARTPDESQPESIAHRT
LGILSMAVVHTTAMASTHMLFDLVSDPDLLEALREEQRRVLPEGWPSINQKAMLEMRLLDSLMRESQRFNPVGEF
TFRRIVRKPIVLSDGYQLQPGQQIAIPAKNLNLDDDIISEADAYNPSRWATQQQASASFAHSSSANLHFGLGRYA
CPGRFFAAYMIKSIMSRLLLEYDIKLQGDGCHRRPPNIISGDKILPNRDAVILLRHRDS*
Coding >Ophun1|6199
ATGCCCTCGAGCATCCTCCTCGTCCAGGCGCCCATCGCCTGCGCCCTTCTTCTCGGCCTGTTGCTTGTCGAACTT
AGCCGGCGAAGAAAGGGTAGCAAGATCCCGACCATCAGACGGTGGCCAGCGCCGTTCCCTGAGATTCTTGATCGT
CTCAGCTACAACCGAAATGCCGTCGCGCTCGTCAGAGAGGGATACACAAAGCATAAAAATGTCCCGTTCAGGCTC
CTCAAGATGGACATGGACTTGGTCGTCATCCCGCTCAAGTACGCCGCTGAGCTACGGGCCGTTACGAGCGACAAG
CTGGATCCTCTGACGGCCAGCTTCGACGACAATGCTGGTCATCTCACCAAGATTCTCCTGGGAAGCGAGCTTCAC
TCCGATGCTATTCACCGGCCTCGCATCATTCCCGTTGTCGTCGACGAGCTCAAGTTTGCCTTTGATCATGTCCTC
GCTCAGGGATCCAAGTCCGGTAAGTCCAACAGCCTCATCATCAACCAGACCACTTACCCCCTCTATCTTACAGAC
TCATGGACTGCCGTGAACCCCTACGACATGGTCCTCGACCTCTCAACCCGCGCCGCAGCAAGGATCTTCGTCGGA
GAGCCCATCTGCCGCGATGAACAGTTCCTCCAAACAACAGCCTCCTACAGCCGCAACAGCTTCAGCACCATCGAC
ACGTTCCGCAACCTCGGCAGCATCATCGGCCTCTTTGGCCGCGCCATGAGCTCTACAGTCACCGACGCCCGCGAT
CAGCTGGCGTATGTTCAACGCCTCCTCGGCGACGAGGTGACGAGGAGAAGAGCCCGGCCGGATGATAAGCACGAT
GACTTCCTTCAGTGGTGTATGGATCTGGCTCGTACCCCGGACGAGTCTCAGCCCGAGTCCATCGCTCATCGTACG
CTCGGGATCCTCAGCATGGCCGTTGTTCATACCACGGCCATGGCTTCGACTCATATGCTCTTCGACCTCGTCTCT
GACCCAGACTTGTTAGAGGCGCTGCGAGAAGAACAGAGACGCGTCTTGCCCGAGGGCTGGCCTTCTATCAACCAA
AAGGCCATGCTGGAGATGAGGCTTCTCGACAGCCTGATGAGAGAGTCTCAGCGCTTCAACCCGGTGGGCGAGTTC
ACCTTCCGCCGCATCGTGAGAAAGCCCATCGTCTTATCCGACGGCTACCAGCTACAACCAGGCCAGCAAATCGCC
ATCCCAGCCAAGAACCTCAATCTCGACGACGACATCATCTCCGAGGCCGACGCCTATAATCCGTCCCGCTGGGCA
ACTCAGCAGCAGGCCTCGGCCTCGTTTGCCCATAGCAGCTCGGCCAACCTCCACTTTGGCCTTGGCCGATATGCT
TGCCCCGGACGCTTCTTTGCCGCGTACATGATCAAATCCATCATGAGTCGCCTCCTGCTGGAGTACGACATCAAA
CTACAAGGAGACGGGTGCCATCGTCGTCCGCCAAACATCATCTCGGGGGATAAGATTCTTCCCAACCGGGATGCC
GTCATTCTTCTCCGCCACCGCGATAGCTGA
Transcript >Ophun1|6199
ATGCCCTCGAGCATCCTCCTCGTCCAGGCGCCCATCGCCTGCGCCCTTCTTCTCGGCCTGTTGCTTGTCGAACTT
AGCCGGCGAAGAAAGGGTAGCAAGATCCCGACCATCAGACGGTGGCCAGCGCCGTTCCCTGAGATTCTTGATCGT
CTCAGCTACAACCGAAATGCCGTCGCGCTCGTCAGAGAGGGATACACAAAGCATAAAAATGTCCCGTTCAGGCTC
CTCAAGATGGACATGGACTTGGTCGTCATCCCGCTCAAGTACGCCGCTGAGCTACGGGCCGTTACGAGCGACAAG
CTGGATCCTCTGACGGCCAGCTTCGACGACAATGCTGGTCATCTCACCAAGATTCTCCTGGGAAGCGAGCTTCAC
TCCGATGCTATTCACCGGCCTCGCATCATTCCCGTTGTCGTCGACGAGCTCAAGTTTGCCTTTGATCATGTCCTC
GCTCAGGGATCCAAGTCCGGTAAGTCCAACAGCCTCATCATCAACCAGACCACTTACCCCCTCTATCTTACAGAC
TCATGGACTGCCGTGAACCCCTACGACATGGTCCTCGACCTCTCAACCCGCGCCGCAGCAAGGATCTTCGTCGGA
GAGCCCATCTGCCGCGATGAACAGTTCCTCCAAACAACAGCCTCCTACAGCCGCAACAGCTTCAGCACCATCGAC
ACGTTCCGCAACCTCGGCAGCATCATCGGCCTCTTTGGCCGCGCCATGAGCTCTACAGTCACCGACGCCCGCGAT
CAGCTGGCGTATGTTCAACGCCTCCTCGGCGACGAGGTGACGAGGAGAAGAGCCCGGCCGGATGATAAGCACGAT
GACTTCCTTCAGTGGTGTATGGATCTGGCTCGTACCCCGGACGAGTCTCAGCCCGAGTCCATCGCTCATCGTACG
CTCGGGATCCTCAGCATGGCCGTTGTTCATACCACGGCCATGGCTTCGACTCATATGCTCTTCGACCTCGTCTCT
GACCCAGACTTGTTAGAGGCGCTGCGAGAAGAACAGAGACGCGTCTTGCCCGAGGGCTGGCCTTCTATCAACCAA
AAGGCCATGCTGGAGATGAGGCTTCTCGACAGCCTGATGAGAGAGTCTCAGCGCTTCAACCCGGTGGGCGAGTTC
ACCTTCCGCCGCATCGTGAGAAAGCCCATCGTCTTATCCGACGGCTACCAGCTACAACCAGGCCAGCAAATCGCC
ATCCCAGCCAAGAACCTCAATCTCGACGACGACATCATCTCCGAGGCCGACGCCTATAATCCGTCCCGCTGGGCA
ACTCAGCAGCAGGCCTCGGCCTCGTTTGCCCATAGCAGCTCGGCCAACCTCCACTTTGGCCTTGGCCGATATGCT
TGCCCCGGACGCTTCTTTGCCGCGTACATGATCAAATCCATCATGAGTCGCCTCCTGCTGGAGTACGACATCAAA
CTACAAGGAGACGGGTGCCATCGTCGTCCGCCAAACATCATCTCGGGGGATAAGATTCTTCCCAACCGGGATGCC
GTCATTCTTCTCCGCCACCGCGATAGCTGA
Gene >Ophun1|6199
ATGCCCTCGAGCATCCTCCTCGTCCAGGCGCCCATCGCCTGCGCCCTTCTTCTCGGCCTGTTGCTTGTCGAACTT
AGCCGGCGAAGAAAGGGTAGCAAGATCCCGACCATCAGACGGTGGCCAGCGCCGTTCCCTGAGATTCTTGATCGT
CTCAGCTACAACCGAAATGCCGTCGCGCTCGTCAGAGAGGGATACACAAAGGTGTGTTTACCTGAGTTGACTCAA
GTTTTCTCTTCTTAACTGCCGTCTTCAGCATAAAAATGTCCCGTTCAGGCTCCTCAAGATGGACATGGACTTGGT
CGTCATCCCGCTCAAGTACGCCGCTGAGCTACGGGCCGTTACGAGCGACAAGCTGGATCCTCTGACGGCCAGCTT
CGACGACAATGCTGGTCATCTCACCAAGATTCTCCTGGGAAGCGAGCTTCACTCCGATGCTATTCACCGGCGTCT
GACTCCAGGGCTTCGTATGTTATATACGTTCTTCAGAAGATGACGATTCTGACTCGTGCAGCTCGCATCATTCCC
GTTGTCGTCGACGAGCTCAAGTTTGCCTTTGATCATGTCCTCGCTCAGGGATCCAAGTCCGGTAAGTCCAACAGC
CTCATCATCAACCAGACCACTTACCCCCTCTATCTTACAGACTCATGGACTGCCGTGAACCCCTACGACATGGTC
CTCGACCTCTCAACCCGCGCCGCAGCAAGGATCTTCGTCGGAGAGCCCATCTGCCGCGATGAACAGTTCCTCCAA
ACAACAGCCTCCTACAGCCGCAACAGCTTCAGCACCATCGACACGTTCCGCAACCTCGGCAGCATCATCGGCCTC
TTTGGCCGCGCCATGAGCTCTACAGTCACCGACGCCCGCGATCAGCTGGCGTATGTTCAACGCCTCCTCGGCGAC
GAGGTGACGAGGAGAAGAGCCCGGCCGGATGATAAGCACGATGACTTCCTTCAGTGGTGTATGGATCTGGCTCGT
ACCCCGGACGAGTCTCAGCCCGAGTCCATCGCTCATCGTACGCTCGGGATCCTCAGCATGGCCGTTGTTCATACC
ACGGCCATGGCTTCGACTCATATGCTCTTCGACCTCGTCTCTGACCCAGACTTGTTAGAGGCGCTGCGAGAAGAA
CAGAGACGCGTCTTGCCCGAGGGCTGGCCTTCTATCAACCAAAAGGCCATGCTGGAGATGAGGCTTCTCGACAGC
CTGATGAGAGAGTCTCAGCGCTTCAACCCGGTGGGCGAGTGTAAGCTGCCACCATCTTCAGTGTGATGCTCGCTG
TTCTCATTGTAACCTCATCTTATAGTCACCTTCCGCCGCATCGTGAGAAAGCCCATCGTCTTATCCGACGGCTAC
CAGCTACAACCAGGCCAGCAAATCGCCATCCCAGCCAAGAACCTCAATCTCGACGACGACATCATCTCCGAGGCC
GACGCCTATAATCCGTCCCGCTGGGCAACTCAGCAGCAGGCCTCGGCCTCGTTTGCCCATAGCAGCTCGGCCAAC
CTCCACTTTGGCCTTGGCCGATATGCTTGCCCCGGACGCTTCTTTGCCGCGGTACGTGTTTGGTGAGAAGGATGG
CAACATATTCTAAAGGCTTACTTGCTGGTTTAGTACATGATCAAATCCATCATGAGTCGCCTCCTGCTGGAGTAC
GACATCAAACTACAAGGAGACGGGTGCCATCGTCGTCCGCCAAACATCATCTCGGGGGATAAGATTCTTCCCAAC
CGGGATGCCGTCATTCTTCTCCGCCACCGCGATAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail