Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6197
Gene name
LocationContig_66:20547..24645
Strand-
Gene length (bp)4098
Transcript length (bp)2550
Coding sequence length (bp)2550
Protein length (aa) 850

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00348 polyprenyl_synt Polyprenyl synthetase 2.3E-21 59 288
PF00348 polyprenyl_synt Polyprenyl synthetase 9.4E-61 563 803

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92236|GGPPS_GIBFU Geranylgeranyl pyrophosphate synthase OS=Gibberella fujikuroi GN=GGS PE=3 SV=1 542 849 1.0E-150
sp|P24322|GGPPS_NEUCR Geranylgeranyl pyrophosphate synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=al-3 PE=2 SV=2 542 847 1.0E-141
sp|B2DBE9|GGS4_PHOAM Geranylgeranyl pyrophosphate synthase D OS=Phomopsis amygdali GN=GGS-D PE=1 SV=1 543 849 2.0E-111
sp|Q9P885|GGPPS_MUCCL Geranylgeranyl pyrophosphate synthase OS=Mucor circinelloides f. lusitanicus GN=carG PE=1 SV=1 552 827 3.0E-108
sp|Q9WTN0|GGPPS_MOUSE Geranylgeranyl pyrophosphate synthase OS=Mus musculus GN=Ggps1 PE=1 SV=1 562 847 4.0E-94
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92236|GGPPS_GIBFU Geranylgeranyl pyrophosphate synthase OS=Gibberella fujikuroi GN=GGS PE=3 SV=1 542 849 1.0E-150
sp|P24322|GGPPS_NEUCR Geranylgeranyl pyrophosphate synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=al-3 PE=2 SV=2 542 847 1.0E-141
sp|B2DBE9|GGS4_PHOAM Geranylgeranyl pyrophosphate synthase D OS=Phomopsis amygdali GN=GGS-D PE=1 SV=1 543 849 2.0E-111
sp|Q9P885|GGPPS_MUCCL Geranylgeranyl pyrophosphate synthase OS=Mucor circinelloides f. lusitanicus GN=carG PE=1 SV=1 552 827 3.0E-108
sp|Q9WTN0|GGPPS_MOUSE Geranylgeranyl pyrophosphate synthase OS=Mus musculus GN=Ggps1 PE=1 SV=1 562 847 4.0E-94
sp|Q6F596|GGPPS_RAT Geranylgeranyl pyrophosphate synthase OS=Rattus norvegicus GN=Ggps1 PE=2 SV=1 562 847 5.0E-93
sp|P56966|GGPPS_BOVIN Geranylgeranyl pyrophosphate synthase OS=Bos taurus GN=GGPS1 PE=1 SV=2 562 847 8.0E-93
sp|O95749|GGPPS_HUMAN Geranylgeranyl pyrophosphate synthase OS=Homo sapiens GN=GGPS1 PE=1 SV=1 562 847 2.0E-91
sp|Q54BK1|GGPPS_DICDI Geranylgeranyl pyrophosphate synthase OS=Dictyostelium discoideum GN=ggps1 PE=3 SV=1 568 833 7.0E-78
sp|Q758K0|GGPPS_ASHGO Geranylgeranyl pyrophosphate synthase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BTS1 PE=3 SV=1 557 819 7.0E-70
sp|Q12051|GGPPS_YEAST Geranylgeranyl pyrophosphate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BTS1 PE=1 SV=1 557 825 4.0E-64
sp|A1C8C3|OPHFS_ASPCL Ophiobolin F synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_076850 PE=1 SV=1 562 847 4.0E-55
sp|B2DBE8|GGS1_PHOAM Geranylgeranyl pyrophosphate synthase A OS=Phomopsis amygdali GN=GGS-A PE=1 SV=1 565 849 4.0E-55
sp|A2PZA5|FUSS_PHOAM Fusicoccadiene synthase OS=Phomopsis amygdali GN=PaFS PE=1 SV=1 561 844 8.0E-52
sp|C9K2Q3|FUSS_ALTBR Fusicoccadiene synthase OS=Alternaria brassicicola GN=bsc8 PE=1 SV=1 562 824 6.0E-43
sp|Q6F596|GGPPS_RAT Geranylgeranyl pyrophosphate synthase OS=Rattus norvegicus GN=Ggps1 PE=2 SV=1 61 320 3.0E-19
sp|P56966|GGPPS_BOVIN Geranylgeranyl pyrophosphate synthase OS=Bos taurus GN=GGPS1 PE=1 SV=2 61 336 3.0E-19
sp|O95749|GGPPS_HUMAN Geranylgeranyl pyrophosphate synthase OS=Homo sapiens GN=GGPS1 PE=1 SV=1 61 336 4.0E-19
sp|Q9WTN0|GGPPS_MOUSE Geranylgeranyl pyrophosphate synthase OS=Mus musculus GN=Ggps1 PE=1 SV=1 61 289 5.0E-19
sp|Q58270|IDSA_METJA Short chain isoprenyl diphosphate synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=idsA PE=3 SV=1 606 824 4.0E-17
sp|A2PZA5|FUSS_PHOAM Fusicoccadiene synthase OS=Phomopsis amygdali GN=PaFS PE=1 SV=1 58 287 9.0E-17
sp|B2DBE9|GGS4_PHOAM Geranylgeranyl pyrophosphate synthase D OS=Phomopsis amygdali GN=GGS-D PE=1 SV=1 58 328 1.0E-16
sp|A1C8C3|OPHFS_ASPCL Ophiobolin F synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_076850 PE=1 SV=1 61 289 3.0E-15
sp|Q9P885|GGPPS_MUCCL Geranylgeranyl pyrophosphate synthase OS=Mucor circinelloides f. lusitanicus GN=carG PE=1 SV=1 61 320 6.0E-15
sp|Q54BK1|GGPPS_DICDI Geranylgeranyl pyrophosphate synthase OS=Dictyostelium discoideum GN=ggps1 PE=3 SV=1 61 289 1.0E-14
sp|P24322|GGPPS_NEUCR Geranylgeranyl pyrophosphate synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=al-3 PE=2 SV=2 61 290 2.0E-14
sp|Q12051|GGPPS_YEAST Geranylgeranyl pyrophosphate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BTS1 PE=1 SV=1 95 273 6.0E-14
sp|P0AD57|ISPB_ECOLI Octaprenyl-diphosphate synthase OS=Escherichia coli (strain K12) GN=ispB PE=1 SV=1 602 813 1.0E-13
sp|P0AD58|ISPB_SHIFL Octaprenyl-diphosphate synthase OS=Shigella flexneri GN=ispB PE=3 SV=1 602 813 1.0E-13
sp|P95999|GGPS_SULSO Geranylgeranyl diphosphate synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gds PE=3 SV=2 606 794 4.0E-13
sp|B2DBE8|GGS1_PHOAM Geranylgeranyl pyrophosphate synthase A OS=Phomopsis amygdali GN=GGS-A PE=1 SV=1 104 274 1.0E-12
sp|C9K2Q3|FUSS_ALTBR Fusicoccadiene synthase OS=Alternaria brassicicola GN=bsc8 PE=1 SV=1 33 288 3.0E-12
sp|Q9UWR6|GFPS_AERPX Geranylfarnesyl diphosphate synthase OS=Aeropyrum pernix GN=fgs PE=1 SV=1 610 824 5.0E-12
sp|Q758K0|GGPPS_ASHGO Geranylgeranyl pyrophosphate synthase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BTS1 PE=3 SV=1 53 272 7.0E-12
sp|O24743|SDSA_RHOCA All-trans-nonaprenyl-diphosphate synthase (geranyl-diphosphate specific) OS=Rhodobacter capsulatus GN=sdsA PE=1 SV=1 602 823 9.0E-12
sp|Q6CBH3|COQ1_YARLI Probable hexaprenyl pyrophosphate synthase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COQ1 PE=3 SV=1 602 805 9.0E-12
sp|Q92236|GGPPS_GIBFU Geranylgeranyl pyrophosphate synthase OS=Gibberella fujikuroi GN=GGS PE=3 SV=1 58 289 1.0E-11
sp|O26156|IDSA_METTH Short chain isoprenyl diphosphate synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=idsA PE=3 SV=1 562 815 1.0E-11
sp|Q53479|IDSA_METTM Short chain isoprenyl diphosphate synthase OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=idsA PE=1 SV=3 602 815 5.0E-11
sp|P44916|ISPB_HAEIN Octaprenyl-diphosphate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ispB PE=1 SV=1 606 774 1.0E-10
sp|P39464|GGPS_SULAC Geranylgeranyl diphosphate synthase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=gds PE=1 SV=1 606 773 1.0E-10
sp|Q5HZ00|SPS3_ARATH Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SPS3 PE=1 SV=1 577 829 4.0E-10
sp|P31171|PREA_CYAPA Prenyl transferase OS=Cyanophora paradoxa GN=preA PE=3 SV=1 602 815 6.0E-10
sp|O43091|DPS1_SCHPO Decaprenyl-diphosphate synthase subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dps1 PE=1 SV=1 593 777 1.0E-09
sp|P55785|HEPS2_GEOSE Heptaprenyl diphosphate synthase component 2 OS=Geobacillus stearothermophilus GN=hepT PE=3 SV=1 608 773 7.0E-09
sp|Q76FS5|SPS2_ARATH Solanesyl diphosphate synthase 2, chloroplastic OS=Arabidopsis thaliana GN=SPS2 PE=1 SV=1 604 783 1.0E-08
sp|O66129|HEXB_MICLU Hexaprenyl-diphosphate synthase large subunit ((2E,6E)-farnesyl-diphosphate specific) OS=Micrococcus luteus GN=hexs-b PE=1 SV=1 608 807 2.0E-08
sp|Q9LJY2|GGPPA_ARATH Geranylgeranyl pyrophosphate synthase 10, mitochondrial OS=Arabidopsis thaliana GN=At3g20160 PE=1 SV=1 559 785 2.0E-08
sp|Q8S948|SPS1_ARATH Solanesyl diphosphate synthase 1 OS=Arabidopsis thaliana GN=SPS1 PE=1 SV=1 602 783 2.0E-08
sp|Q0INZ4|SPS3_ORYSJ Probable solanesyl-diphosphate synthase 3, chloroplastic (Fragment) OS=Oryza sativa subsp. japonica GN=SPS3 PE=3 SV=1 602 807 4.0E-08
sp|Q8PW34|GGPP_METMA Geranylgeranyl diphosphate synthase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1767 PE=3 SV=1 606 825 4.0E-08
sp|P31114|HEPS2_BACSU Heptaprenyl diphosphate synthase component 2 OS=Bacillus subtilis (strain 168) GN=hepT PE=1 SV=1 608 836 5.0E-08
sp|Q08291|ISPA_GEOSE Farnesyl diphosphate synthase OS=Geobacillus stearothermophilus PE=1 SV=1 565 803 8.0E-08
sp|Q75HZ9|SPS2_ORYSJ Solanesyl-diphosphate synthase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=SPS2 PE=1 SV=2 602 784 8.0E-08
sp|Q7S565|COQ1_NEUCR Probable hexaprenyl pyrophosphate synthase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU02305 PE=3 SV=1 596 823 2.0E-07
sp|Q653T6|SPS1_ORYSJ Solanesyl-diphosphate synthase 1, mitochondrial OS=Oryza sativa subsp. japonica GN=SPS1 PE=1 SV=1 567 823 3.0E-07
sp|Q97W92|HEXPP_SULSO Hexaprenyl pyrophosphate synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gdS-2 PE=1 SV=1 606 745 6.0E-07
sp|P57537|ISPA_BUCAI Farnesyl diphosphate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ispA PE=3 SV=1 561 752 6.0E-07
sp|P51268|PREA_PORPU Prenyl transferase OS=Porphyra purpurea GN=preA PE=3 SV=1 602 784 7.0E-07
sp|O66952|ISPA_AQUAE Farnesyl diphosphate synthase OS=Aquifex aeolicus (strain VF5) GN=ispA PE=3 SV=1 606 757 1.0E-06
sp|Q5T2R2|DPS1_HUMAN Decaprenyl-diphosphate synthase subunit 1 OS=Homo sapiens GN=PDSS1 PE=1 SV=1 577 777 2.0E-06
sp|P22939|ISPA_ECOLI Farnesyl diphosphate synthase OS=Escherichia coli (strain K12) GN=ispA PE=1 SV=1 571 770 3.0E-06
sp|P18900|COQ1_YEAST Hexaprenyl pyrophosphate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COQ1 PE=1 SV=1 602 683 3.0E-06
sp|Q54VJ9|DPS1_DICDI Decaprenyl-diphosphate synthase OS=Dictyostelium discoideum GN=coq1 PE=3 SV=1 602 829 7.0E-06
sp|Q1XDL8|PREA_PYRYE Prenyl transferase OS=Pyropia yezoensis GN=preA PE=3 SV=1 602 784 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0008299 isoprenoid biosynthetic process Yes
GO:0006720 isoprenoid metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 323 345 22
2 382 399 17
3 411 433 22
4 443 465 22
5 477 499 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6197
MLDSLRDRFRVTDVATIVAAFSMGFIAKRSSASKPELSVQQYGYCKKLLNNTSKPQDVECPYEYLVRLYGKHHFR
PFVDEFQPTLQRDDPVKYDLVLDIMDAVHFALILVDDISDDSYRRKDQPTAHLLFGASETANRAYLVLTTVINRA
LRERQVLGVELMKALEKILQGQDMSLVWRRDGLEAFPYQGEESILAYKNMAMLKTGTLFILLGRLLLDGGDGLDD
LMTRFGWYAQLQNDCKNIYSSEYNGSKGAVAEDLRNGELSFPIVVALNDQSSGPMLRRALQTRAGPDVEAALDAL
QAPQVQKVCIEAMRQAAYLEIQWLADTLVALMGAGWIINYAAMIYHSYHGQTYSMAIIPLCNNIGWELVYTLVYP
SPNRVELAVFAAGVSLNVVIMAAATRAARTEWRHSPLVAANTPLIFAGGTLLCFTGHLALAAQIGPGLAYSWGAV
VCQLVLSIGGLCQLLQRNSTRGTSWTLWLSRFLGSCCTVGFASLRWKYWPEAFGWLADPLVLWSLAAFVVVDTTY
GSETPSLDSAQTRTPIDKYARLDLDFSPQRHWNQDKEKVIRAPFDYTASHPGKDFRSKVIAAFDAWLQVPPASLD
VITKVIGMLHESSLLMDDVQDSSALRRGFPVAHSIFGVAQTINSANYVCSLAMEELEKLKNPQAISIFIQEIINL
YRGQGMELYWRDSLTCPSEEDYLEMVANKTGGLFRLGVRLMQAESESRTDFVPLVDLVGLIFQIRDDFLNLSAEY
TKNKGECEDLTEGKFSFPIIHSIRSDPSNLQLINILKQKTTDTQVKRYAVSYMEGTGSFAYTRSVVATLLERARR
LAVELDGGQGRVDSILEFLAKMEI*
Coding >Ophun1|6197
ATGCTCGACTCACTCAGGGACCGCTTCCGCGTCACCGACGTCGCGACTATTGTGGCCGCCTTCTCAATGGGCTTC
ATCGCCAAGAGATCCTCAGCGTCGAAGCCGGAATTGTCCGTCCAGCAGTACGGCTACTGCAAGAAGCTGCTCAAC
AATACCAGCAAGCCTCAGGACGTTGAGTGTCCGTACGAGTATCTGGTCCGTCTATATGGGAAGCATCACTTCAGG
CCCTTTGTCGATGAGTTCCAGCCGACACTGCAGAGAGACGACCCGGTCAAGTACGATTTGGTGCTGGACATCATG
GACGCCGTTCACTTTGCCCTCATTCTCGTCGACGACATCTCAGACGATAGCTACCGGCGAAAGGACCAGCCTACT
GCTCACCTGCTGTTCGGCGCCAGCGAGACGGCCAACCGGGCCTATCTGGTGCTGACGACGGTCATCAACCGCGCC
CTGCGAGAGCGTCAAGTGCTAGGCGTCGAGCTGATGAAGGCGTTGGAGAAGATTTTGCAAGGACAGGACATGTCT
CTTGTCTGGCGACGCGATGGGCTGGAGGCGTTTCCTTATCAGGGTGAGGAGAGCATCCTGGCGTACAAGAACATG
GCTATGCTGAAGACGGGGACCTTGTTCATCCTGTTGGGGAGGCTGCTTCTCGACGGCGGAGACGGGCTAGACGAT
CTGATGACGCGGTTTGGCTGGTACGCTCAACTCCAAAACGACTGCAAAAACATCTACTCGTCCGAGTACAACGGC
AGCAAAGGCGCCGTAGCCGAAGATCTCCGCAACGGCGAGCTATCCTTCCCCATCGTCGTCGCCCTCAACGACCAG
AGCAGCGGGCCCATGCTGCGGAGAGCGCTACAGACGAGGGCCGGACCGGACGTCGAGGCTGCTCTCGACGCGCTG
CAGGCGCCTCAGGTTCAGAAGGTGTGTATCGAGGCTATGAGACAGGCGGCCTACCTCGAAATCCAATGGCTCGCC
GACACACTCGTCGCCCTCATGGGCGCAGGCTGGATCATCAACTACGCCGCCATGATCTACCACTCCTACCACGGT
CAAACCTACAGCATGGCCATCATCCCCCTCTGCAACAACATCGGCTGGGAACTCGTCTACACCCTCGTCTACCCG
TCCCCCAACCGAGTCGAGCTGGCCGTCTTCGCCGCTGGCGTGAGCCTCAACGTCGTCATCATGGCGGCTGCTACC
CGGGCAGCGAGGACTGAGTGGCGGCACTCGCCTCTGGTTGCTGCCAACACGCCTCTCATCTTTGCGGGGGGCACG
CTGCTGTGCTTCACGGGGCACCTGGCGCTGGCTGCTCAGATTGGGCCCGGGCTGGCTTACTCGTGGGGGGCTGTC
GTTTGCCAGCTTGTTCTCAGCATTGGGGGGTTGTGCCAGCTGCTACAGCGGAATAGCACGAGAGGGACTTCGTGG
ACTCTGTGGTTGAGCCGTTTCCTCGGCTCCTGCTGCACAGTTGGCTTCGCCTCACTGCGGTGGAAGTACTGGCCC
GAGGCTTTTGGATGGCTGGCCGATCCGCTGGTGCTCTGGAGCCTGGCTGCATTCGTCGTCGTCGATACTACCTAC
GGTAGCGAAACCCCCTCCCTAGACTCGGCACAGACACGCACCCCCATCGACAAGTATGCCCGTCTAGACCTCGAC
TTCTCCCCCCAGAGACACTGGAATCAAGACAAGGAAAAAGTGATCCGCGCCCCCTTCGACTACACCGCCAGCCAC
CCAGGCAAAGACTTCCGATCCAAGGTCATCGCCGCCTTCGACGCCTGGCTTCAAGTCCCGCCCGCCAGTCTCGAC
GTCATCACAAAGGTCATAGGCATGCTGCACGAGTCATCGCTTCTCATGGACGACGTGCAGGATTCCTCGGCGCTA
CGACGCGGATTCCCCGTCGCTCACAGCATCTTCGGCGTAGCTCAGACTATCAACTCGGCCAACTATGTCTGCTCC
CTCGCCATGGAGGAGCTCGAGAAACTCAAGAATCCACAGGCTATATCGATATTCATCCAGGAGATTATTAACCTC
TACCGCGGCCAGGGCATGGAGCTCTACTGGAGGGATAGTCTGACCTGCCCGTCCGAGGAAGACTATCTCGAGATG
GTTGCCAACAAGACGGGCGGTCTGTTCCGGCTCGGCGTAAGGCTTATGCAGGCAGAGTCGGAATCTCGGACGGAT
TTCGTGCCGCTGGTAGACCTTGTCGGCCTGATATTTCAGATTCGTGACGACTTTCTCAATCTCTCGGCAGAGTAT
ACCAAGAATAAGGGCGAGTGCGAAGACCTAACAGAAGGGAAATTCTCCTTTCCCATCATCCACAGCATCCGGTCC
GACCCTTCCAACTTACAGCTCATCAACATACTCAAGCAAAAGACGACGGATACGCAGGTGAAGCGCTACGCCGTT
TCTTACATGGAGGGCACGGGGAGCTTTGCGTACACGCGCTCCGTTGTGGCTACGCTTCTGGAGCGGGCGAGGAGG
TTGGCGGTCGAGTTGGATGGCGGGCAGGGACGCGTAGACAGCATACTAGAGTTTCTGGCCAAGATGGAGATATAG
Transcript >Ophun1|6197
ATGCTCGACTCACTCAGGGACCGCTTCCGCGTCACCGACGTCGCGACTATTGTGGCCGCCTTCTCAATGGGCTTC
ATCGCCAAGAGATCCTCAGCGTCGAAGCCGGAATTGTCCGTCCAGCAGTACGGCTACTGCAAGAAGCTGCTCAAC
AATACCAGCAAGCCTCAGGACGTTGAGTGTCCGTACGAGTATCTGGTCCGTCTATATGGGAAGCATCACTTCAGG
CCCTTTGTCGATGAGTTCCAGCCGACACTGCAGAGAGACGACCCGGTCAAGTACGATTTGGTGCTGGACATCATG
GACGCCGTTCACTTTGCCCTCATTCTCGTCGACGACATCTCAGACGATAGCTACCGGCGAAAGGACCAGCCTACT
GCTCACCTGCTGTTCGGCGCCAGCGAGACGGCCAACCGGGCCTATCTGGTGCTGACGACGGTCATCAACCGCGCC
CTGCGAGAGCGTCAAGTGCTAGGCGTCGAGCTGATGAAGGCGTTGGAGAAGATTTTGCAAGGACAGGACATGTCT
CTTGTCTGGCGACGCGATGGGCTGGAGGCGTTTCCTTATCAGGGTGAGGAGAGCATCCTGGCGTACAAGAACATG
GCTATGCTGAAGACGGGGACCTTGTTCATCCTGTTGGGGAGGCTGCTTCTCGACGGCGGAGACGGGCTAGACGAT
CTGATGACGCGGTTTGGCTGGTACGCTCAACTCCAAAACGACTGCAAAAACATCTACTCGTCCGAGTACAACGGC
AGCAAAGGCGCCGTAGCCGAAGATCTCCGCAACGGCGAGCTATCCTTCCCCATCGTCGTCGCCCTCAACGACCAG
AGCAGCGGGCCCATGCTGCGGAGAGCGCTACAGACGAGGGCCGGACCGGACGTCGAGGCTGCTCTCGACGCGCTG
CAGGCGCCTCAGGTTCAGAAGGTGTGTATCGAGGCTATGAGACAGGCGGCCTACCTCGAAATCCAATGGCTCGCC
GACACACTCGTCGCCCTCATGGGCGCAGGCTGGATCATCAACTACGCCGCCATGATCTACCACTCCTACCACGGT
CAAACCTACAGCATGGCCATCATCCCCCTCTGCAACAACATCGGCTGGGAACTCGTCTACACCCTCGTCTACCCG
TCCCCCAACCGAGTCGAGCTGGCCGTCTTCGCCGCTGGCGTGAGCCTCAACGTCGTCATCATGGCGGCTGCTACC
CGGGCAGCGAGGACTGAGTGGCGGCACTCGCCTCTGGTTGCTGCCAACACGCCTCTCATCTTTGCGGGGGGCACG
CTGCTGTGCTTCACGGGGCACCTGGCGCTGGCTGCTCAGATTGGGCCCGGGCTGGCTTACTCGTGGGGGGCTGTC
GTTTGCCAGCTTGTTCTCAGCATTGGGGGGTTGTGCCAGCTGCTACAGCGGAATAGCACGAGAGGGACTTCGTGG
ACTCTGTGGTTGAGCCGTTTCCTCGGCTCCTGCTGCACAGTTGGCTTCGCCTCACTGCGGTGGAAGTACTGGCCC
GAGGCTTTTGGATGGCTGGCCGATCCGCTGGTGCTCTGGAGCCTGGCTGCATTCGTCGTCGTCGATACTACCTAC
GGTAGCGAAACCCCCTCCCTAGACTCGGCACAGACACGCACCCCCATCGACAAGTATGCCCGTCTAGACCTCGAC
TTCTCCCCCCAGAGACACTGGAATCAAGACAAGGAAAAAGTGATCCGCGCCCCCTTCGACTACACCGCCAGCCAC
CCAGGCAAAGACTTCCGATCCAAGGTCATCGCCGCCTTCGACGCCTGGCTTCAAGTCCCGCCCGCCAGTCTCGAC
GTCATCACAAAGGTCATAGGCATGCTGCACGAGTCATCGCTTCTCATGGACGACGTGCAGGATTCCTCGGCGCTA
CGACGCGGATTCCCCGTCGCTCACAGCATCTTCGGCGTAGCTCAGACTATCAACTCGGCCAACTATGTCTGCTCC
CTCGCCATGGAGGAGCTCGAGAAACTCAAGAATCCACAGGCTATATCGATATTCATCCAGGAGATTATTAACCTC
TACCGCGGCCAGGGCATGGAGCTCTACTGGAGGGATAGTCTGACCTGCCCGTCCGAGGAAGACTATCTCGAGATG
GTTGCCAACAAGACGGGCGGTCTGTTCCGGCTCGGCGTAAGGCTTATGCAGGCAGAGTCGGAATCTCGGACGGAT
TTCGTGCCGCTGGTAGACCTTGTCGGCCTGATATTTCAGATTCGTGACGACTTTCTCAATCTCTCGGCAGAGTAT
ACCAAGAATAAGGGCGAGTGCGAAGACCTAACAGAAGGGAAATTCTCCTTTCCCATCATCCACAGCATCCGGTCC
GACCCTTCCAACTTACAGCTCATCAACATACTCAAGCAAAAGACGACGGATACGCAGGTGAAGCGCTACGCCGTT
TCTTACATGGAGGGCACGGGGAGCTTTGCGTACACGCGCTCCGTTGTGGCTACGCTTCTGGAGCGGGCGAGGAGG
TTGGCGGTCGAGTTGGATGGCGGGCAGGGACGCGTAGACAGCATACTAGAGTTTCTGGCCAAGATGGAGATATAG
Gene >Ophun1|6197
ATGCTCGACTCACTCAGGGACCGCTTCCGCGTCACCGACGTCGCGACTATTGTGGCCGCCTTCTCAATGGGCTTC
ATCGCCAAGAGATCCTCAGCGTCGAAGCCGGAATTGTCCGTCCAGCAGTACGGCTACTGCAAGAAGCTGCTCAAC
AATACCAGCAAGCCTCAGGACGTTGAGTGTCCGTACGAGTATCTGGTCCGTCTATATGGGAAGCATCACTTCAGG
CCCTTTGTCGATGAGTTCCAGCCGACACTGCAGAGAGACGACCCGGTCAAGTACGATTTGGTGCTGGACATCATG
GACGCCGTTCACTTTGCCCTCATTCTCGTCGACGACATCTCAGACGATAGCTACCGGCGAAAGGACCAGCCTACT
GCTCACCTGCTGTTCGGCGCCAGCGAGACGGCCAACCGGGCCTATCTGGTGCTGACGACGGTCATCAACCGCGCC
CTGCGAGAGCGTCAAGTGCTAGGCGTCGAGCTGATGAAGGCGTTGGAGAAGATTTTGCAAGGACAGGACATGTCT
CTTGTCTGGCGACGCGATGGGCTGGAGGCGTTTCCTTATCAGGGTGAGGAGAGCATCCTGGCGTACAAGAACATG
GCTATGCTGAAGACGGGGACCTTGTTCATCCTGTTGGGGAGGCTGCTTCTCGACGGCGGAGACGGGCTAGACGAT
CTGATGACGCGGTTTGGGTAGGTCTTGTTCTATATCTTGTTGATATTGATACAAGTATGCTAACAGGAGGGCCAG
CTGGTACGCTCAACTCCAAAACGACTGCAAAAACATCTACTCGTCCGAGTACAACGGCAGCAAAGGCGCCGTAGC
CGAAGATCTCCGCAACGGCGAGCTATCCTTCCCCATCGTCGTCGCCCTCAACGACCAGAGCAGCGGGCCCATGCT
GCGGAGAGCGCTACAGACGAGGGCCGGACCGGACGTCGAGGCTGCTCTCGACGCGCTGCAGGCGCCTCAGGTTCA
GAAGGTGTGTATCGAGGCTATGAGACAGGCGGGTGTGGGGATGGAGAGGATGGTGAGGCTGTGGGGGAGGCGGGA
GAAGATGAGTGCTGGGGGAGAGAGTTGCTGATGGGGTAGGGGAGGGAGAGTTGGCAAGTTGTGAGTTGACTATGT
GCGTGTATGTTTGTATCGACTGGGAGTTGTAATGGTGAGTTCAAGTTTCTGCATGTAATCCAGTTGAGACTTGGA
GTTGAACCTGAGTTATTGTCATCACGGGACTACATATTGCATACATGTAGCCGATATATCCGCTTATGAACACAA
CGAGTAAGCCATGTAATCAGTTCATCAACTTGATGTAAGGTGCCGCCAGACGAGAGTCGATAGCAACACAACGCT
CCGTTCGTCACACGTCGGACAAGCCGGTGCGACGTAACGAATGCGACTCGGCCCAGCTCCGGAACGAGAACCGCC
GCGTTATCGTGGTAGTGAGATGATACATGGCTCGGAGCAAACCGACTGGATGGCACCTTGACGTAGCCGAGGCTG
CGCGTTGAAGGCATCAAAGAATTCGTAGGGTAATGGAGCATTGCAATTGATCTAGTCTAATGTGAGTTGAAACGT
TCGTACAAGTTGAAGCTTGGCTTTCTGATTGGATGCTTAGGGATCATCGTATAGGTCTATACATGTGAGAGACCA
TGCATTTCTTCAGGATGGACAGCCGCGTGCGTCTACATCTCTCATTGACAGATACATACATACAGATAGATACAT
GAACAGCTCAAAGAAGAGCAAGAAATAACCTCAGGGAACCAGTTCATGTAGTATCGTTCAGAGACTCAACCCCTA
TAAGACCATCTACATAGTCCAACATGGCAGCACGAACAGCATCACAACTCCGTGACGAAACCAACAACCCACCAT
GGACGGCTTCTCCCACTCACAACCCCCTCAAGCCTACCTCGAAATCCAATGGCTCGCCGACACACTCGTCGCCCT
CATGGGCGCAGGCTGGATCATCAACTACGCCGCCATGATCTACCACTCCTACCACGGTCAAACCTACAGCATGGC
CATCATCCCCCTCTGCAACAACATCGGCTGGGAACTCGTCTACACCCTCGTCTACCCGTCCCCCAACCGAGTCGA
GCTGGCCGTCTTCGCCGCTGGCGTGAGCCTCAACGTCGTCATCATGGCGGCTGCTACCCGGGCAGCGAGGACTGA
GTGGCGGCACTCGCCTCTGGTTGCTGCCAACACGCCTCTCATCTTTGCGGGGGGCACGCTGCTGTGCTTCACGGG
GCACCTGGCGCTGGCTGCTCAGATTGGGCCCGGGCTGGCTTACTCGTGGGGGGCTGTCGTTTGCCAGCTTGTTCT
CAGCATTGGGGGGTTGTGCCAGCTGCTACAGCGGAATAGCACGAGAGGGACTTCGTGGACTCTGTGGTAAGTGAT
CGCTATGGTCAAGACTTCCCGTCTCTTACACGTGTACATGTAGGTTGAGCCGTTTCCTCGGCTCCTGCTGCACAG
TTGGCTTCGCCTCACTGCGGTGGAAGTACTGGCCCGAGGCTTTTGGATGGCTGGCCGATCCGCTGGTGCTCTGGA
GCCTGGCTGCATTCGTCGTCGTCGATACTACCTACGGTGTCTGCCTATACCTCGTGTCTCGGCAGCAGCAGCAGC
AGAGCCATGTACATGTAATAAAGGTGCAGTGACGATGTAGTAATTGCCTCCATCTATCGTTCCCGTTAGTCTGTT
TAGTTTGAGATAAGGCAATTGGGAGTGTACGATGTGCCAGTTGCGGTCATACGTACATTGAGTATGAATGTACAT
GGCGGTTGCGATGATACGTGCGCACATCATGAATTGCTGTCTATGTTGCATCAAGTGTGCTTTACGAATCTGACC
AAGACGTCGAGTTGCATTCGTACACGTATGGCTGCCCTTGATATAGATCTACCTCGTTTTCTGCATATGTACAGG
TCAACGTTCAACCACCTCACCCTCACCCAAGCTGGAACAAGCCTTCATCCTCTCCACTCCACAACTTGGTTGACA
CAAAGAGATTGCGTGTTCCTGAGTCTAGACCGGGACAAGAGGAAGAAATCCATGTTCAAGTCCCACGAAAGCAAC
ATCACACACCCCTTCACTCAACCTCCCACCATGGCCATCAAACAACTCCAGAGCGAAACCCCCTCCCTAGACTCG
GCACAGACACGCACCCCCATCGACAAGTATGCCCGTCTAGACCTCGACTTCTCCCCCCAGAGACACTGGAATCAA
GACAAGGAAAAAGTGATCCGCGCCCCCTTCGACTACACCGCCAGCCACCCAGGCAAAGACTTCCGATCCAAGGTC
ATCGCCGCCTTCGACGCCTGGCTTCAAGTCCCGCCCGCCAGTCTCGACGTCATCACAAAGGTCATAGGCATGCTG
CACGAGTCATCGCTTCTCATGGACGACGTGCAGGATTCCTCGGCGCTACGACGCGGATTCCCCGTCGCTCACAGC
ATCTTCGGCGTAGCTCAGACTATCAACTCGGCCAACTATGTCTGCTCCCTCGCCATGGAGGAGCTCGAGAAACTC
AAGAATCCACAGGCTATATCGATATTCATCCAGGAGATTATTAACCTCTACCGCGGCCAGGGCATGGAGCTCTAC
TGGAGGGATAGTCTGACCTGCCCGTCCGAGGAAGACTATCTCGAGATGGTTGCCAACAAGACGGGCGGTCTGTTC
CGGCTCGGCGTAAGGCTTATGCAGGCAGAGTCGGAATCTCGGACGGATTTCGTGCCGCTGGTAGACCTTGTCGGC
CTGATATTTCAGATTCGTGACGACTTTCTCAATCTCTCGGCAGAGTATACCAAGAATAAGGGCGAGTGCGAAGAC
CTAACAGAAGGGAAATTCTCCTTTCCCATCATCCACAGCATCCGGTCCGACCCTTCCAACTTACAGCTCATCAAC
ATACTCAAGCAAAAGACGACGGATACGCAGGTGAAGCGCTACGCCGTTTCTTACATGGAGGGCACGGGGAGCTTT
GCGTACACGCGCTCCGTTGTGGCTACGCTTCTGGAGCGGGCGAGGAGGTTGGCGGTCGAGTTGGATGGCGGGCAG
GGACGCGTAGACAGCATACTAGAGTTTCTGGCCAAGATGGAGATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail