Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|619
Gene name
LocationContig_12:11387..13178
Strand+
Gene length (bp)1791
Transcript length (bp)1791
Coding sequence length (bp)1791
Protein length (aa) 597

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.7E-24 81 515

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 66 577 5.0E-34
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 63 581 7.0E-33
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 64 579 1.0E-32
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 66 579 1.0E-30
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 5 581 1.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 66 577 5.0E-34
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 63 581 7.0E-33
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 64 579 1.0E-32
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 66 579 1.0E-30
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 5 581 1.0E-30
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 69 579 2.0E-29
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 65 579 7.0E-27
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 58 581 7.0E-27
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 66 577 1.0E-26
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 88 579 2.0E-26
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 63 577 2.0E-26
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 63 576 2.0E-25
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 63 579 3.0E-25
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 63 580 2.0E-24
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 63 579 2.0E-24
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 63 579 4.0E-24
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 47 579 3.0E-23
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 47 578 2.0E-22
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 64 579 4.0E-22
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 47 579 4.0E-20
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 63 573 2.0E-19
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 63 580 2.0E-19
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 63 580 3.0E-19
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 63 573 1.0E-18
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 64 576 8.0E-18
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 49 542 5.0E-17
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 49 542 5.0E-17
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 49 273 3.0E-12
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 47 588 3.0E-12
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 65 263 1.0E-08
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 73 253 5.0E-08
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 51 262 2.0E-07
sp|B7N2F5|MDTL_ECO81 Multidrug resistance protein MdtL OS=Escherichia coli O81 (strain ED1a) GN=mdtL PE=3 SV=1 102 261 4.0E-07
sp|Q83PL6|MDTL_SHIFL Multidrug resistance protein MdtL OS=Shigella flexneri GN=mdtL PE=3 SV=1 102 261 4.0E-07
sp|B7M562|MDTL_ECO8A Multidrug resistance protein MdtL OS=Escherichia coli O8 (strain IAI1) GN=mdtL PE=3 SV=1 102 259 4.0E-07
sp|A7ZTR5|MDTL_ECO24 Multidrug resistance protein MdtL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtL PE=3 SV=1 102 259 4.0E-07
sp|Q3YWK3|MDTL_SHISS Multidrug resistance protein MdtL OS=Shigella sonnei (strain Ss046) GN=mdtL PE=3 SV=1 102 261 4.0E-07
sp|Q31UW4|MDTL_SHIBS Multidrug resistance protein MdtL OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtL PE=3 SV=1 102 261 4.0E-07
sp|B2TUR5|MDTL_SHIB3 Multidrug resistance protein MdtL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtL PE=3 SV=1 102 261 4.0E-07
sp|B1IX28|MDTL_ECOLC Multidrug resistance protein MdtL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtL PE=3 SV=1 102 261 4.0E-07
sp|A8A6H2|MDTL_ECOHS Multidrug resistance protein MdtL OS=Escherichia coli O9:H4 (strain HS) GN=mdtL PE=3 SV=1 102 261 4.0E-07
sp|Q8FBV0|MDTL_ECOL6 Multidrug resistance protein MdtL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtL PE=3 SV=1 102 261 4.0E-07
sp|B7UMH7|MDTL_ECO27 Multidrug resistance protein MdtL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtL PE=3 SV=1 102 275 5.0E-07
sp|B7L855|MDTL_ECO55 Multidrug resistance protein MdtL OS=Escherichia coli (strain 55989 / EAEC) GN=mdtL PE=3 SV=1 102 261 5.0E-07
sp|C4ZYY8|MDTL_ECOBW Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtL PE=3 SV=1 102 261 5.0E-07
sp|P31462|MDTL_ECOLI Multidrug resistance protein MdtL OS=Escherichia coli (strain K12) GN=mdtL PE=1 SV=2 102 261 5.0E-07
sp|B6I3U3|MDTL_ECOSE Multidrug resistance protein MdtL OS=Escherichia coli (strain SE11) GN=mdtL PE=3 SV=1 102 261 5.0E-07
sp|B1X9T9|MDTL_ECODH Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / DH10B) GN=mdtL PE=3 SV=1 102 261 5.0E-07
sp|Q0TAZ8|MDTL_ECOL5 Multidrug resistance protein MdtL OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtL PE=3 SV=1 102 261 9.0E-07
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 85 273 1.0E-06
sp|B7MGD1|MDTL_ECO45 Multidrug resistance protein MdtL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtL PE=3 SV=1 102 275 1.0E-06
sp|A1AHP3|MDTL_ECOK1 Multidrug resistance protein MdtL OS=Escherichia coli O1:K1 / APEC GN=mdtL PE=3 SV=1 102 275 1.0E-06
sp|Q1R4M4|MDTL_ECOUT Multidrug resistance protein MdtL OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtL PE=3 SV=1 102 275 1.0E-06
sp|B7LK52|MDTL_ESCF3 Multidrug resistance protein MdtL OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtL PE=3 SV=1 102 275 1.0E-06
sp|Q328Z8|MDTL_SHIDS Multidrug resistance protein MdtL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mdtL PE=3 SV=1 102 275 1.0E-06
sp|P32482|CMLA_PSEAI Chloramphenicol resistance protein OS=Pseudomonas aeruginosa GN=cmlA PE=3 SV=2 94 237 1.0E-06
sp|Q8XB24|MDTL_ECO57 Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 GN=mdtL PE=3 SV=1 122 275 1.0E-06
sp|B5YXB4|MDTL_ECO5E Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtL PE=3 SV=1 122 275 1.0E-06
sp|Q0SYP9|MDTL_SHIF8 Multidrug resistance protein MdtL OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtL PE=3 SV=1 102 259 2.0E-06
sp|B7NF27|MDTL_ECOLU Multidrug resistance protein MdtL OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtL PE=3 SV=1 102 259 3.0E-06
sp|B1LL36|MDTL_ECOSM Multidrug resistance protein MdtL OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtL PE=3 SV=1 102 261 3.0E-06
sp|B7NR12|MDTL_ECO7I Multidrug resistance protein MdtL OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtL PE=3 SV=1 102 261 5.0E-06
sp|A8ACM0|MDTL_CITK8 Multidrug resistance protein MdtL OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtL PE=3 SV=1 122 275 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

Domain # Start End Length
1 74 96 22
2 111 133 22
3 140 162 22
4 167 189 22
5 201 223 22
6 238 255 17
7 351 373 22
8 393 412 19
9 452 474 22
10 484 506 22
11 545 567 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|619
MPYKQPTATIEVRHQDDSTSDKTAIVDATSTISYLYLTFDTPLPLPDLSDESLPPIPNLQRLRRPLSWSPARKYG
VLAVACLAVFISAYSAGAYSPAAALAAEKLATTNTVMLIGMVTFCLGLGLGPMFLAPVSEIWGRLPVFAAAAVNL
LVSQIICSVAEHPAVLLTMRFLVGVGASVFSIIASGVVVDLWDKQDRNTPMAIFSGFLIAGYAAGPLVATVLVGA
IEDHWLLWRWTFWHQAMADAAVLTAFFVVIRESRESVVLTKRARLLNKWYEELETRGSYGLWMTDKMSYHQSSPS
SSKSATKRTGNSSASAESTLGTYRRIRWLVRDDKERLSSGRIIATSIFRPLYLLFTEPIVFFFSLWTAFAWGVLY
LSFSILPLLHKAEPERSIRVYGAMITASAFGTAASIVQQRLLRHPQWREHENESFLFVDSRFWAFMRRRFPVEAP
EARLYMTCLSALLLPLGLAVALVLPRFTEKYAEALGMGIATWGIFSIYLASLNYLADAYGTYASSTLASQNFCRN
MTGGSFQLLTAAMLSNLGRLGVGAVLGSIAALLSVTPWVFVFFGERMRASSKFARVSCMSRHDLPSKSNTR*
Coding >Ophun1|619
ATGCCATACAAGCAACCAACAGCGACGATCGAGGTCCGTCATCAAGACGACTCGACTTCGGACAAGACGGCGATT
GTCGATGCGACGAGTACCATCTCATATCTCTACCTCACTTTCGACACGCCCCTCCCCCTTCCCGACCTCTCGGAC
GAGAGTCTCCCTCCAATCCCCAACCTGCAAAGGCTCAGGAGACCGCTCAGCTGGAGCCCGGCGCGGAAATACGGC
GTGTTGGCCGTAGCCTGCTTAGCCGTCTTCATATCCGCCTACTCGGCTGGCGCCTACTCACCAGCAGCCGCTCTG
GCAGCCGAGAAGCTGGCGACGACCAACACGGTGATGCTCATCGGCATGGTAACCTTCTGCCTCGGCTTGGGCCTG
GGTCCCATGTTCCTGGCCCCCGTGTCAGAGATCTGGGGCCGTCTCCCCGTCTTCGCCGCCGCGGCTGTCAACCTG
CTCGTCTCCCAGATCATCTGCTCCGTCGCCGAGCACCCAGCCGTCCTGCTAACAATGCGCTTCCTAGTCGGCGTC
GGCGCCTCCGTCTTCAGCATCATCGCCAGCGGCGTCGTCGTCGATCTCTGGGACAAGCAAGATAGGAACACGCCC
ATGGCCATCTTCAGCGGCTTCCTCATTGCCGGCTATGCCGCGGGCCCGCTCGTGGCCACCGTCTTGGTGGGCGCC
ATTGAGGATCACTGGCTGCTCTGGAGATGGACCTTTTGGCATCAGGCTATGGCCGACGCCGCCGTCTTGACCGCC
TTCTTCGTCGTCATCAGGGAGAGTCGCGAATCGGTGGTGCTGACCAAGAGGGCGCGCCTCCTGAATAAGTGGTAC
GAGGAGCTCGAGACGCGAGGCTCGTACGGGCTATGGATGACGGACAAGATGAGCTACCACCAGTCGTCGCCTTCG
TCGTCCAAATCTGCAACGAAACGGACGGGCAACTCTTCAGCATCGGCAGAGTCAACGCTCGGAACCTACCGACGA
ATCCGATGGCTTGTCCGAGACGACAAGGAGCGCCTATCGTCAGGCCGCATCATCGCCACCTCGATTTTTCGCCCC
TTGTACCTGCTCTTCACCGAACCCATCGTCTTCTTCTTCTCGCTCTGGACGGCCTTCGCCTGGGGCGTCCTCTAC
CTTTCCTTTTCCATCCTGCCGCTGCTTCACAAGGCGGAGCCGGAGAGGTCGATACGCGTGTACGGGGCCATGATC
ACGGCGTCGGCCTTCGGCACCGCCGCCAGCATCGTTCAGCAGCGGCTGCTGAGGCATCCGCAGTGGAGGGAGCAC
GAAAACGAGAGCTTCCTCTTTGTCGACTCTCGCTTCTGGGCCTTTATGAGGAGGCGCTTCCCCGTCGAGGCGCCC
GAGGCGAGGCTGTACATGACGTGCCTCTCGGCCCTCCTCTTGCCGCTTGGTCTCGCCGTCGCCCTCGTGCTGCCG
CGGTTCACGGAGAAATACGCAGAGGCTCTCGGGATGGGTATCGCGACTTGGGGTATCTTCTCCATCTACCTGGCC
AGTCTAAACTACCTGGCCGACGCCTACGGTACGTACGCGTCATCTACTCTGGCGTCGCAGAACTTTTGCCGCAAC
ATGACTGGTGGAAGCTTCCAGCTCCTGACGGCGGCCATGCTGTCCAACCTGGGCCGTCTGGGCGTGGGGGCCGTT
TTGGGGAGCATCGCCGCGCTTCTGTCCGTTACCCCCTGGGTCTTTGTGTTTTTCGGGGAGCGGATGCGGGCCAGC
AGCAAGTTTGCCAGGGTAAGTTGCATGTCCCGTCATGATTTACCGTCCAAGTCTAACACGCGGTGA
Transcript >Ophun1|619
ATGCCATACAAGCAACCAACAGCGACGATCGAGGTCCGTCATCAAGACGACTCGACTTCGGACAAGACGGCGATT
GTCGATGCGACGAGTACCATCTCATATCTCTACCTCACTTTCGACACGCCCCTCCCCCTTCCCGACCTCTCGGAC
GAGAGTCTCCCTCCAATCCCCAACCTGCAAAGGCTCAGGAGACCGCTCAGCTGGAGCCCGGCGCGGAAATACGGC
GTGTTGGCCGTAGCCTGCTTAGCCGTCTTCATATCCGCCTACTCGGCTGGCGCCTACTCACCAGCAGCCGCTCTG
GCAGCCGAGAAGCTGGCGACGACCAACACGGTGATGCTCATCGGCATGGTAACCTTCTGCCTCGGCTTGGGCCTG
GGTCCCATGTTCCTGGCCCCCGTGTCAGAGATCTGGGGCCGTCTCCCCGTCTTCGCCGCCGCGGCTGTCAACCTG
CTCGTCTCCCAGATCATCTGCTCCGTCGCCGAGCACCCAGCCGTCCTGCTAACAATGCGCTTCCTAGTCGGCGTC
GGCGCCTCCGTCTTCAGCATCATCGCCAGCGGCGTCGTCGTCGATCTCTGGGACAAGCAAGATAGGAACACGCCC
ATGGCCATCTTCAGCGGCTTCCTCATTGCCGGCTATGCCGCGGGCCCGCTCGTGGCCACCGTCTTGGTGGGCGCC
ATTGAGGATCACTGGCTGCTCTGGAGATGGACCTTTTGGCATCAGGCTATGGCCGACGCCGCCGTCTTGACCGCC
TTCTTCGTCGTCATCAGGGAGAGTCGCGAATCGGTGGTGCTGACCAAGAGGGCGCGCCTCCTGAATAAGTGGTAC
GAGGAGCTCGAGACGCGAGGCTCGTACGGGCTATGGATGACGGACAAGATGAGCTACCACCAGTCGTCGCCTTCG
TCGTCCAAATCTGCAACGAAACGGACGGGCAACTCTTCAGCATCGGCAGAGTCAACGCTCGGAACCTACCGACGA
ATCCGATGGCTTGTCCGAGACGACAAGGAGCGCCTATCGTCAGGCCGCATCATCGCCACCTCGATTTTTCGCCCC
TTGTACCTGCTCTTCACCGAACCCATCGTCTTCTTCTTCTCGCTCTGGACGGCCTTCGCCTGGGGCGTCCTCTAC
CTTTCCTTTTCCATCCTGCCGCTGCTTCACAAGGCGGAGCCGGAGAGGTCGATACGCGTGTACGGGGCCATGATC
ACGGCGTCGGCCTTCGGCACCGCCGCCAGCATCGTTCAGCAGCGGCTGCTGAGGCATCCGCAGTGGAGGGAGCAC
GAAAACGAGAGCTTCCTCTTTGTCGACTCTCGCTTCTGGGCCTTTATGAGGAGGCGCTTCCCCGTCGAGGCGCCC
GAGGCGAGGCTGTACATGACGTGCCTCTCGGCCCTCCTCTTGCCGCTTGGTCTCGCCGTCGCCCTCGTGCTGCCG
CGGTTCACGGAGAAATACGCAGAGGCTCTCGGGATGGGTATCGCGACTTGGGGTATCTTCTCCATCTACCTGGCC
AGTCTAAACTACCTGGCCGACGCCTACGGTACGTACGCGTCATCTACTCTGGCGTCGCAGAACTTTTGCCGCAAC
ATGACTGGTGGAAGCTTCCAGCTCCTGACGGCGGCCATGCTGTCCAACCTGGGCCGTCTGGGCGTGGGGGCCGTT
TTGGGGAGCATCGCCGCGCTTCTGTCCGTTACCCCCTGGGTCTTTGTGTTTTTCGGGGAGCGGATGCGGGCCAGC
AGCAAGTTTGCCAGGGTAAGTTGCATGTCCCGTCATGATTTACCGTCCAAGTCTAACACGCGGTGA
Gene >Ophun1|619
ATGCCATACAAGCAACCAACAGCGACGATCGAGGTCCGTCATCAAGACGACTCGACTTCGGACAAGACGGCGATT
GTCGATGCGACGAGTACCATCTCATATCTCTACCTCACTTTCGACACGCCCCTCCCCCTTCCCGACCTCTCGGAC
GAGAGTCTCCCTCCAATCCCCAACCTGCAAAGGCTCAGGAGACCGCTCAGCTGGAGCCCGGCGCGGAAATACGGC
GTGTTGGCCGTAGCCTGCTTAGCCGTCTTCATATCCGCCTACTCGGCTGGCGCCTACTCACCAGCAGCCGCTCTG
GCAGCCGAGAAGCTGGCGACGACCAACACGGTGATGCTCATCGGCATGGTAACCTTCTGCCTCGGCTTGGGCCTG
GGTCCCATGTTCCTGGCCCCCGTGTCAGAGATCTGGGGCCGTCTCCCCGTCTTCGCCGCCGCGGCTGTCAACCTG
CTCGTCTCCCAGATCATCTGCTCCGTCGCCGAGCACCCAGCCGTCCTGCTAACAATGCGCTTCCTAGTCGGCGTC
GGCGCCTCCGTCTTCAGCATCATCGCCAGCGGCGTCGTCGTCGATCTCTGGGACAAGCAAGATAGGAACACGCCC
ATGGCCATCTTCAGCGGCTTCCTCATTGCCGGCTATGCCGCGGGCCCGCTCGTGGCCACCGTCTTGGTGGGCGCC
ATTGAGGATCACTGGCTGCTCTGGAGATGGACCTTTTGGCATCAGGCTATGGCCGACGCCGCCGTCTTGACCGCC
TTCTTCGTCGTCATCAGGGAGAGTCGCGAATCGGTGGTGCTGACCAAGAGGGCGCGCCTCCTGAATAAGTGGTAC
GAGGAGCTCGAGACGCGAGGCTCGTACGGGCTATGGATGACGGACAAGATGAGCTACCACCAGTCGTCGCCTTCG
TCGTCCAAATCTGCAACGAAACGGACGGGCAACTCTTCAGCATCGGCAGAGTCAACGCTCGGAACCTACCGACGA
ATCCGATGGCTTGTCCGAGACGACAAGGAGCGCCTATCGTCAGGCCGCATCATCGCCACCTCGATTTTTCGCCCC
TTGTACCTGCTCTTCACCGAACCCATCGTCTTCTTCTTCTCGCTCTGGACGGCCTTCGCCTGGGGCGTCCTCTAC
CTTTCCTTTTCCATCCTGCCGCTGCTTCACAAGGCGGAGCCGGAGAGGTCGATACGCGTGTACGGGGCCATGATC
ACGGCGTCGGCCTTCGGCACCGCCGCCAGCATCGTTCAGCAGCGGCTGCTGAGGCATCCGCAGTGGAGGGAGCAC
GAAAACGAGAGCTTCCTCTTTGTCGACTCTCGCTTCTGGGCCTTTATGAGGAGGCGCTTCCCCGTCGAGGCGCCC
GAGGCGAGGCTGTACATGACGTGCCTCTCGGCCCTCCTCTTGCCGCTTGGTCTCGCCGTCGCCCTCGTGCTGCCG
CGGTTCACGGAGAAATACGCAGAGGCTCTCGGGATGGGTATCGCGACTTGGGGTATCTTCTCCATCTACCTGGCC
AGTCTAAACTACCTGGCCGACGCCTACGGTACGTACGCGTCATCTACTCTGGCGTCGCAGAACTTTTGCCGCAAC
ATGACTGGTGGAAGCTTCCAGCTCCTGACGGCGGCCATGCTGTCCAACCTGGGCCGTCTGGGCGTGGGGGCCGTT
TTGGGGAGCATCGCCGCGCTTCTGTCCGTTACCCCCTGGGTCTTTGTGTTTTTCGGGGAGCGGATGCGGGCCAGC
AGCAAGTTTGCCAGGGTAAGTTGCATGTCCCGTCATGATTTACCGTCCAAGTCTAACACGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail