Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6183
Gene name
LocationContig_659:210..2383
Strand-
Gene length (bp)2173
Transcript length (bp)2121
Coding sequence length (bp)2121
Protein length (aa) 707

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 2.1E-126 173 617
PF14558 TRP_N ML-like domain 1.0E-35 27 162

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39719|FLC2_YEAST Flavin carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC2 PE=1 SV=2 9 685 8.0E-37
sp|Q08844|YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR365C PE=1 SV=1 25 544 2.0E-31
sp|Q08967|FLC1_YEAST Flavin carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC1 PE=1 SV=1 27 591 4.0E-31
sp|P53121|FLC3_YEAST Putative flavin carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC3 PE=1 SV=1 34 618 4.0E-30
sp|O74520|YCPE_SCHPO Uncharacterized membrane protein C663.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.14c PE=3 SV=2 20 556 7.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39719|FLC2_YEAST Flavin carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC2 PE=1 SV=2 9 685 8.0E-37
sp|Q08844|YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR365C PE=1 SV=1 25 544 2.0E-31
sp|Q08967|FLC1_YEAST Flavin carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC1 PE=1 SV=1 27 591 4.0E-31
sp|P53121|FLC3_YEAST Putative flavin carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC3 PE=1 SV=1 34 618 4.0E-30
sp|O74520|YCPE_SCHPO Uncharacterized membrane protein C663.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.14c PE=3 SV=2 20 556 7.0E-17
sp|Q09917|PKD2_SCHPO TRP-like ion channel pkd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkd2 PE=1 SV=1 27 162 8.0E-15
sp|Q09917|PKD2_SCHPO TRP-like ion channel pkd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkd2 PE=1 SV=1 325 590 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 342 364 22
2 388 410 22
3 425 447 22
4 484 503 19
5 513 530 17
6 537 559 22
7 574 596 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6183
MARLDASLCRLLLWALAFSSTRADDVLKTDGFSSCGGDSIKVDKLDIAYDRDNKALTFDVAGTSLREQNVTAHLE
VTAYGNSVYKNSFNPCDAATFVQRLCPVPKGSFSAQGSQKVPDDIASKIPDVAFRVPDIAAQATLQLKGLDGDEV
ACIRSSVSNGKTANIGAARVLAVGVVSVAFAASGVAHASSLVSGAAAGGAGGVVAPSPSFSEAFGWFQGMAVSGM
FSVNYPPVYRSFSSVFSFSACLPKDWVNLQLFIDNFRRGAGGNLTEDNVDYLRKATIVYPDGSRTSPNQGMVKFK
RAVDDFAALVARDEGNQTSNLQHAVQGIQAYAARLSVPKSDIFMTALLVVAIIVAAIVVGILLVKVVLEAWALFG
SFPKSLTGFRKHYWGSIARTITSLILILYGIWVLYCIFQFTHGDTVAAKALAAVTLILFTAVLAFFTWKIWSVAR
RLKREGGDADALYNDKQIWVKYSLFYEAYKKSYWWLFVPTIIYMFIKGATLAATDGNGRTQTVSQLIIEALMLAL
LLWSRPYERRSGNVVNIAIAVVRVLSVACILVFVEEFGIRQTTQTIAGVVLIVVQSTLTAVLAVLIAWNAFNACC
KINPHRKRRKDMEKLQRDGDALTPLDARNSLLLDPARKQPASILSLEKPPVMSPPSEPSRFYDSFPVPPRSSTPA
DAATRPLVDDAAPMGSSALERGTGYGHGGWR*
Coding >Ophun1|6183
ATGGCTCGTCTAGATGCCTCGCTTTGCAGGCTACTGCTATGGGCCCTCGCCTTCTCCTCGACTCGCGCCGATGAC
GTTCTCAAGACGGATGGCTTCAGCTCGTGTGGTGGTGACTCGATCAAGGTCGACAAGCTGGATATAGCCTACGAT
CGGGACAACAAGGCCCTCACCTTCGACGTGGCCGGCACCAGCCTCCGGGAGCAAAACGTCACGGCCCATCTCGAA
GTCACGGCCTACGGAAACTCGGTCTACAAGAACAGCTTCAACCCGTGTGATGCTGCCACTTTTGTGCAGCGTCTG
TGTCCCGTGCCCAAGGGCTCGTTCAGCGCTCAGGGCTCGCAGAAAGTACCGGATGATATCGCCTCCAAGATTCCG
GACGTGGCCTTTCGCGTGCCTGACATTGCCGCTCAGGCGACGCTGCAGCTCAAGGGCCTGGATGGCGACGAGGTG
GCCTGCATCCGCTCCTCCGTGTCCAACGGCAAGACGGCCAACATCGGAGCCGCGCGAGTCCTCGCCGTCGGAGTC
GTCAGCGTCGCCTTCGCCGCTTCGGGCGTCGCACACGCCTCGTCTCTCGTCTCGGGCGCTGCGGCTGGTGGTGCG
GGAGGCGTCGTCGCTCCGAGTCCCAGCTTCTCCGAGGCCTTTGGCTGGTTCCAGGGCATGGCTGTCAGCGGCATG
TTCTCGGTCAACTACCCGCCCGTTTACCGCAGCTTCAGCTCCGTCTTTTCCTTCTCCGCCTGTCTGCCTAAAGAT
TGGGTGAATCTCCAGTTGTTTATTGATAATTTTCGGAGGGGTGCTGGTGGAAACCTGACCGAGGATAACGTCGAC
TATCTTCGCAAGGCCACCATCGTCTACCCGGATGGATCCCGAACCAGCCCCAACCAGGGCATGGTCAAGTTCAAG
CGAGCCGTCGATGACTTTGCCGCCCTCGTCGCCCGCGATGAGGGGAACCAGACGTCCAACCTCCAGCACGCCGTC
CAGGGCATCCAGGCCTACGCCGCCAGGCTCTCGGTCCCCAAGTCGGACATCTTCATGACGGCCCTTCTCGTCGTC
GCCATCATCGTCGCCGCCATCGTCGTCGGCATCCTCCTCGTCAAGGTCGTCCTCGAAGCCTGGGCCCTCTTCGGC
AGCTTCCCCAAGTCCCTCACCGGCTTCCGCAAGCACTACTGGGGCTCCATCGCCCGGACCATCACCTCGCTCATC
CTCATCCTCTACGGCATCTGGGTCCTCTACTGCATCTTCCAGTTCACCCACGGCGATACCGTCGCCGCAAAGGCC
CTCGCCGCCGTCACCCTCATCCTCTTCACCGCCGTCCTCGCCTTCTTCACCTGGAAGATCTGGAGCGTCGCCCGT
CGTCTGAAGCGCGAGGGCGGCGACGCAGACGCTCTCTACAACGACAAGCAGATCTGGGTCAAGTACTCCCTCTTC
TACGAGGCCTACAAGAAGAGCTACTGGTGGCTCTTCGTCCCCACCATCATCTACATGTTCATCAAGGGCGCCACC
CTCGCAGCCACCGACGGCAACGGCAGGACCCAAACTGTCTCCCAGCTCATCATCGAAGCCCTCATGCTCGCCCTC
CTCCTCTGGAGCCGACCCTACGAGCGCCGCTCCGGCAACGTGGTCAACATCGCCATCGCCGTCGTCCGCGTCTTG
TCCGTAGCCTGCATCCTCGTCTTCGTCGAGGAGTTTGGAATCCGTCAGACGACGCAGACCATCGCCGGCGTCGTC
CTCATCGTCGTTCAGTCTACGCTCACGGCCGTACTGGCCGTGCTCATTGCTTGGAATGCCTTTAACGCCTGCTGC
AAGATCAACCCGCACCGCAAGCGAAGAAAGGACATGGAGAAACTCCAGCGAGACGGCGACGCCCTAACCCCCCTC
GACGCCCGCAACTCCCTCCTCCTCGACCCCGCCCGCAAACAACCCGCCTCCATCCTCTCCCTCGAGAAACCCCCC
GTCATGAGCCCCCCCTCGGAACCATCCCGCTTCTACGACTCCTTCCCCGTCCCGCCCCGCTCCTCGACCCCCGCC
GACGCCGCCACCCGGCCCCTCGTCGACGACGCCGCTCCCATGGGGTCGTCGGCCTTGGAGAGGGGGACGGGGTAT
GGGCATGGGGGATGGCGGTAG
Transcript >Ophun1|6183
ATGGCTCGTCTAGATGCCTCGCTTTGCAGGCTACTGCTATGGGCCCTCGCCTTCTCCTCGACTCGCGCCGATGAC
GTTCTCAAGACGGATGGCTTCAGCTCGTGTGGTGGTGACTCGATCAAGGTCGACAAGCTGGATATAGCCTACGAT
CGGGACAACAAGGCCCTCACCTTCGACGTGGCCGGCACCAGCCTCCGGGAGCAAAACGTCACGGCCCATCTCGAA
GTCACGGCCTACGGAAACTCGGTCTACAAGAACAGCTTCAACCCGTGTGATGCTGCCACTTTTGTGCAGCGTCTG
TGTCCCGTGCCCAAGGGCTCGTTCAGCGCTCAGGGCTCGCAGAAAGTACCGGATGATATCGCCTCCAAGATTCCG
GACGTGGCCTTTCGCGTGCCTGACATTGCCGCTCAGGCGACGCTGCAGCTCAAGGGCCTGGATGGCGACGAGGTG
GCCTGCATCCGCTCCTCCGTGTCCAACGGCAAGACGGCCAACATCGGAGCCGCGCGAGTCCTCGCCGTCGGAGTC
GTCAGCGTCGCCTTCGCCGCTTCGGGCGTCGCACACGCCTCGTCTCTCGTCTCGGGCGCTGCGGCTGGTGGTGCG
GGAGGCGTCGTCGCTCCGAGTCCCAGCTTCTCCGAGGCCTTTGGCTGGTTCCAGGGCATGGCTGTCAGCGGCATG
TTCTCGGTCAACTACCCGCCCGTTTACCGCAGCTTCAGCTCCGTCTTTTCCTTCTCCGCCTGTCTGCCTAAAGAT
TGGGTGAATCTCCAGTTGTTTATTGATAATTTTCGGAGGGGTGCTGGTGGAAACCTGACCGAGGATAACGTCGAC
TATCTTCGCAAGGCCACCATCGTCTACCCGGATGGATCCCGAACCAGCCCCAACCAGGGCATGGTCAAGTTCAAG
CGAGCCGTCGATGACTTTGCCGCCCTCGTCGCCCGCGATGAGGGGAACCAGACGTCCAACCTCCAGCACGCCGTC
CAGGGCATCCAGGCCTACGCCGCCAGGCTCTCGGTCCCCAAGTCGGACATCTTCATGACGGCCCTTCTCGTCGTC
GCCATCATCGTCGCCGCCATCGTCGTCGGCATCCTCCTCGTCAAGGTCGTCCTCGAAGCCTGGGCCCTCTTCGGC
AGCTTCCCCAAGTCCCTCACCGGCTTCCGCAAGCACTACTGGGGCTCCATCGCCCGGACCATCACCTCGCTCATC
CTCATCCTCTACGGCATCTGGGTCCTCTACTGCATCTTCCAGTTCACCCACGGCGATACCGTCGCCGCAAAGGCC
CTCGCCGCCGTCACCCTCATCCTCTTCACCGCCGTCCTCGCCTTCTTCACCTGGAAGATCTGGAGCGTCGCCCGT
CGTCTGAAGCGCGAGGGCGGCGACGCAGACGCTCTCTACAACGACAAGCAGATCTGGGTCAAGTACTCCCTCTTC
TACGAGGCCTACAAGAAGAGCTACTGGTGGCTCTTCGTCCCCACCATCATCTACATGTTCATCAAGGGCGCCACC
CTCGCAGCCACCGACGGCAACGGCAGGACCCAAACTGTCTCCCAGCTCATCATCGAAGCCCTCATGCTCGCCCTC
CTCCTCTGGAGCCGACCCTACGAGCGCCGCTCCGGCAACGTGGTCAACATCGCCATCGCCGTCGTCCGCGTCTTG
TCCGTAGCCTGCATCCTCGTCTTCGTCGAGGAGTTTGGAATCCGTCAGACGACGCAGACCATCGCCGGCGTCGTC
CTCATCGTCGTTCAGTCTACGCTCACGGCCGTACTGGCCGTGCTCATTGCTTGGAATGCCTTTAACGCCTGCTGC
AAGATCAACCCGCACCGCAAGCGAAGAAAGGACATGGAGAAACTCCAGCGAGACGGCGACGCCCTAACCCCCCTC
GACGCCCGCAACTCCCTCCTCCTCGACCCCGCCCGCAAACAACCCGCCTCCATCCTCTCCCTCGAGAAACCCCCC
GTCATGAGCCCCCCCTCGGAACCATCCCGCTTCTACGACTCCTTCCCCGTCCCGCCCCGCTCCTCGACCCCCGCC
GACGCCGCCACCCGGCCCCTCGTCGACGACGCCGCTCCCATGGGGTCGTCGGCCTTGGAGAGGGGGACGGGGTAT
GGGCATGGGGGATGGCGGTAG
Gene >Ophun1|6183
ATGGCTCGTCTAGATGCCTCGCTTTGCAGGCTACTGCTATGGGCCCTCGCCTTCTCCTCGACTCGCGCCGATGAC
GTTCTCAAGACGGATGGCTTCAGCTCGTGTGGTGGTGACTCGATCAAGGTCGACAAGCTGGATATAGCCTACGAT
CGGGACAACAAGGCCCTCACCTTCGACGTGGCCGGCACCAGCCTCCGGGAGCAAAACGTCACGGCCCATCTCGAA
GTCACGGCCTACGGAAACTCGGTCTACAAGAACAGCTTCAACCCGTGTGATGCTGCCACTTTTGTGCAGCGTCTG
TGTCCCGTGCCCAAGGGCTCGTTCAGCGCTCAGGGCTCGCAGAAAGTACCGGATGATATCGCCTCCAAGATTCCG
GACGTGGCCTTTCGCGTGCCTGACATTGCCGCTCAGGCGACGCTGCAGCTCAAGGGCCTGGATGGCGACGAGGTG
GCCTGCATCCGCTCCTCCGTGTCCAACGGCAAGACGGCCAACATCGGAGCCGCGCGAGTCCTCGCCGTCGGAGTC
GTCAGCGTCGCCTTCGCCGCTTCGGGCGTCGCACACGCCTCGTCTCTCGTCTCGGGCGCTGCGGCTGGTGGTGCG
GGAGGCGTCGTCGCTCCGAGTCCCAGCTTCTCCGAGGCCTTTGGCTGGTTCCAGGGCATGGCTGTCAGCGGCATG
TTCTCGGTCAACTACCCGCCCGTTTACCGCAGCTTCAGCTCCGTCTTTTCCTTCTCCGCCTGTCTGCCTAAAGAT
TGGGTGAATCTCCAGTTGTTTATTGATAATTTTCGGAGGGGTGCTGGTGGAAACCTGACCGAGGATAACGTCGAC
TATCTTCGCAAGGCCACCATCGTCTACCCGGATGGATCCCGAACCAGCCCCAACCAGGGCATGGTCAAGTTCAAG
CGAGCCGTCGATGACTTTGCCGCCCTCGTCGCCCGCGATGAGGGGAACCAGACGTCCAACCTCCAGCACGCCGTC
CAGGGCATCCAGGCCTACGCCGCCAGGCTCTCGGTCCCCAAGTCGGACATCTTCATGACGGCCCTTCTCGTCGTC
GCCATCATCGTCGCCGCCATCGTCGTCGGCATCCTCCTCGTCAAGGTCGTCCTCGAAGCCTGGGCCCTCTTCGGC
AGCTTCCCCAAGTCCCTCACCGGCTTCCGCAAGCACTACTGGGGCTCCATCGCCCGGACCATCACCTCGCTCATC
CTCATCCTCTACGGCATCTGGGTCCTCTACTGCATCTTCCAGTTCACCCACGGCGATACCGTCGCCGCAAAGGCC
CTCGCCGCCGTCACCCTCATCCTCTTCACCGCCGTCCTCGCCTTCTTCACCTGGAAGATCTGGAGCGTCGCCCGT
CGTCTGAAGCGCGAGGGCGGCGACGCAGACGCTCTCTACAACGACAAGCAGATCTGGGTCAAGTACTCCCTCTTC
TACGAGGCCTACAAGAAGAGCTACTGGTGGCTCTTCGTCCCCACCATCATCTACATGTTCATCAAGGGCGCCACC
CTCGCAGCCACCGACGGCAACGGCAGGACCCAAACTGTCTCCCAGCTCATCATCGAAGCCCTCATGCTCGCCCTC
CTCCTCTGGAGCCGACCCTACGAGCGCCGCTCCGGCAACGTGGTCAACATCGCCATCGCCGTCGTCCGCGTCTTG
TCCGTAGCCTGCATCCTCGTCTTCGTCGAGGAGTTTGGAATCCGTCAGACGACGCAGACCATCGCCGGCGTCGTC
CTCATCGTCGTTCAGTCTACGCTCACGGCCGTACTGGCCGTGCTCATTGCTTGGAATGCCTTTAACGCCTGCTGC
AAGATCAACCCGCACCGCAAGCGAAGAAAGGACATGGGTAAGCTTCATCTTCATCTCCGTCATCCACCTCCCCTA
ACCCATGACCGCAGAGAAACTCCAGCGAGACGGCGACGCCCTAACCCCCCTCGACGCCCGCAACTCCCTCCTCCT
CGACCCCGCCCGCAAACAACCCGCCTCCATCCTCTCCCTCGAGAAACCCCCCGTCATGAGCCCCCCCTCGGAACC
ATCCCGCTTCTACGACTCCTTCCCCGTCCCGCCCCGCTCCTCGACCCCCGCCGACGCCGCCACCCGGCCCCTCGT
CGACGACGCCGCTCCCATGGGGTCGTCGGCCTTGGAGAGGGGGACGGGGTATGGGCATGGGGGATGGCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail