Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6182
Gene name
LocationContig_658:8219..9116
Strand-
Gene length (bp)897
Transcript length (bp)897
Coding sequence length (bp)897
Protein length (aa) 299

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03328 HpcH_HpaI HpcH/HpaI aldolase/citrate lyase family 5.2E-43 5 218
PF15617 C-C_Bond_Lyase C-C_Bond_Lyase of the TIM-Barrel fold 5.3E-08 193 282

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N0X4|CLYBL_HUMAN Citrate lyase subunit beta-like protein, mitochondrial OS=Homo sapiens GN=CLYBL PE=1 SV=2 8 280 6.0E-40
sp|P44460|CITE_HAEIN Citrate lyase subunit beta OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=citE PE=3 SV=1 1 280 2.0E-39
sp|Q5I0K3|CLYBL_RAT Citrate lyase subunit beta-like protein, mitochondrial OS=Rattus norvegicus GN=Clybl PE=2 SV=2 8 280 4.0E-39
sp|Q8R4N0|CLYBL_MOUSE Citrate lyase subunit beta-like protein, mitochondrial OS=Mus musculus GN=Clybl PE=1 SV=2 8 280 9.0E-39
sp|P17725|CITE_KLEPN Citrate lyase subunit beta OS=Klebsiella pneumoniae GN=citE PE=1 SV=2 1 280 1.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N0X4|CLYBL_HUMAN Citrate lyase subunit beta-like protein, mitochondrial OS=Homo sapiens GN=CLYBL PE=1 SV=2 8 280 6.0E-40
sp|P44460|CITE_HAEIN Citrate lyase subunit beta OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=citE PE=3 SV=1 1 280 2.0E-39
sp|Q5I0K3|CLYBL_RAT Citrate lyase subunit beta-like protein, mitochondrial OS=Rattus norvegicus GN=Clybl PE=2 SV=2 8 280 4.0E-39
sp|Q8R4N0|CLYBL_MOUSE Citrate lyase subunit beta-like protein, mitochondrial OS=Mus musculus GN=Clybl PE=1 SV=2 8 280 9.0E-39
sp|P17725|CITE_KLEPN Citrate lyase subunit beta OS=Klebsiella pneumoniae GN=citE PE=1 SV=2 1 280 1.0E-37
sp|P0A9I1|CITE_ECOLI Citrate lyase subunit beta OS=Escherichia coli (strain K12) GN=citE PE=2 SV=1 1 283 4.0E-34
sp|P0A9I2|CITE_ECOL6 Citrate lyase subunit beta OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=citE PE=3 SV=1 1 283 4.0E-34
sp|O53078|CITE_LEUMC Citrate lyase subunit beta OS=Leuconostoc mesenteroides subsp. cremoris GN=citE PE=3 SV=1 8 280 5.0E-34
sp|D3JV05|MCTE_RHOS4 (3S)-malyl-CoA thioesterase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=mcl2 PE=1 SV=1 2 280 6.0E-32
sp|A3PN16|MCTE_RHOS1 (3S)-malyl-CoA thioesterase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=mcl2 PE=3 SV=1 2 280 2.0E-31
sp|B9KNB6|MCTE_RHOSK (3S)-malyl-CoA thioesterase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=mcl2 PE=3 SV=1 2 280 2.0E-31
sp|A4WNM9|MCTE_RHOS5 (3S)-malyl-CoA thioesterase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=mcl2 PE=3 SV=1 2 280 1.0E-30
sp|Q9RUZ0|CITEL_DEIRA Citrate lyase subunit beta-like protein OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_1240 PE=1 SV=1 1 276 2.0E-30
sp|D5AR83|MCAL_RHOCB L-malyl-CoA/beta-methylmalyl-CoA lyase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=mcl1 PE=3 SV=1 1 279 7.0E-25
sp|B6E2X2|MCAL_RHOCA L-malyl-CoA/beta-methylmalyl-CoA lyase OS=Rhodobacter capsulatus GN=mcl1 PE=1 SV=1 1 279 7.0E-25
sp|A4WVF5|MCAL_RHOS5 L-malyl-CoA/beta-methylmalyl-CoA lyase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=mcl1 PE=3 SV=2 9 279 2.0E-23
sp|B9KLE8|MCAL_RHOSK L-malyl-CoA/beta-methylmalyl-CoA lyase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=mcl1 PE=3 SV=2 9 279 1.0E-22
sp|Q3J5L6|MCAL_RHOS4 L-malyl-CoA/beta-methylmalyl-CoA lyase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=mcl1 PE=1 SV=1 9 279 1.0E-22
sp|A3PGR7|MCAL_RHOS1 L-malyl-CoA/beta-methylmalyl-CoA lyase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=mcl1 PE=3 SV=1 9 279 1.0E-22
sp|P9WPE1|CITEL_MYCTU Citrate lyase subunit beta-like protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=citE PE=1 SV=1 11 278 9.0E-19
sp|P9WPE0|CITEL_MYCTO Citrate lyase subunit beta-like protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=citE PE=3 SV=1 11 278 9.0E-19
sp|S5N020|MCLA_CHLAU Malyl-CoA/beta-methylmalyl-CoA/citramalyl-CoA lyase OS=Chloroflexus aurantiacus GN=mcl PE=1 SV=1 50 278 2.0E-13
sp|A9WC35|MCLA_CHLAA Malyl-CoA/beta-methylmalyl-CoA/citramalyl-CoA lyase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=mclA PE=3 SV=1 50 278 2.0E-13
sp|Q5V463|MCAL_HALMA L-malyl-CoA/beta-methylmalyl-CoA lyase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=citE1 PE=1 SV=1 9 264 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6182
MLVKSLRLASDNITYDLEDSVTPARKPEARQDLKAHLARLTCRPPAVAELAVRVNAVSTPHSIHDLTVAASSPLV
DAVVVPKVESAEDVTFVSSVLRHVASDRQTQGSRNPISIIALIESANAVMNLAAISKASPHLDGLIFAAEDFALD
LSITRTPSLTEFLYARSAIVTAARAARLTSAIDLVCTSYKGEEGLSRLRQECAGGKSMGFNGKQCIHPDQLQTVQ
AMFAPSREDVEWAVRVVMADEKATAAGRGAWTLDGKMIDAPVVGKARAIVSKAESCGFDVPGLRLRWADQEPE*
Coding >Ophun1|6182
ATGCTCGTCAAATCCCTCCGCCTGGCATCAGACAACATCACCTACGACCTCGAGGACTCCGTCACTCCCGCCCGT
AAGCCAGAGGCTCGTCAAGACCTCAAGGCTCATCTCGCCCGCCTCACTTGTCGCCCTCCCGCCGTCGCGGAGCTC
GCCGTTCGCGTCAACGCCGTGTCGACGCCTCACTCCATCCATGACCTCACCGTCGCAGCCTCGTCGCCCCTCGTC
GATGCAGTCGTCGTCCCCAAGGTCGAATCGGCTGAAGACGTCACCTTTGTATCTTCCGTCTTGCGCCACGTCGCG
TCCGACCGCCAAACCCAAGGCTCCCGGAACCCCATCAGCATCATCGCTCTCATTGAATCCGCCAACGCCGTCATG
AACCTCGCCGCTATATCCAAGGCCTCTCCCCACCTCGACGGCCTCATCTTTGCAGCCGAAGACTTTGCCCTCGAC
CTCTCCATCACCCGCACGCCCTCGCTGACCGAGTTCCTCTACGCCCGCTCCGCAATCGTCACCGCCGCCCGCGCA
GCTCGCCTGACCAGCGCCATAGATCTCGTCTGCACCTCTTACAAGGGGGAAGAGGGTCTTTCCCGGCTTCGCCAA
GAGTGCGCCGGCGGCAAGTCCATGGGCTTCAACGGGAAGCAGTGTATCCACCCCGATCAGCTTCAAACCGTCCAA
GCCATGTTCGCCCCTTCGAGGGAAGACGTCGAGTGGGCCGTCCGTGTCGTCATGGCCGATGAAAAGGCCACGGCC
GCCGGTCGAGGCGCCTGGACGCTCGACGGCAAAATGATCGACGCCCCCGTCGTGGGCAAGGCGCGCGCCATCGTT
TCCAAGGCCGAGAGCTGCGGCTTTGATGTGCCGGGCCTTCGTCTGCGCTGGGCAGACCAGGAGCCGGAGTGA
Transcript >Ophun1|6182
ATGCTCGTCAAATCCCTCCGCCTGGCATCAGACAACATCACCTACGACCTCGAGGACTCCGTCACTCCCGCCCGT
AAGCCAGAGGCTCGTCAAGACCTCAAGGCTCATCTCGCCCGCCTCACTTGTCGCCCTCCCGCCGTCGCGGAGCTC
GCCGTTCGCGTCAACGCCGTGTCGACGCCTCACTCCATCCATGACCTCACCGTCGCAGCCTCGTCGCCCCTCGTC
GATGCAGTCGTCGTCCCCAAGGTCGAATCGGCTGAAGACGTCACCTTTGTATCTTCCGTCTTGCGCCACGTCGCG
TCCGACCGCCAAACCCAAGGCTCCCGGAACCCCATCAGCATCATCGCTCTCATTGAATCCGCCAACGCCGTCATG
AACCTCGCCGCTATATCCAAGGCCTCTCCCCACCTCGACGGCCTCATCTTTGCAGCCGAAGACTTTGCCCTCGAC
CTCTCCATCACCCGCACGCCCTCGCTGACCGAGTTCCTCTACGCCCGCTCCGCAATCGTCACCGCCGCCCGCGCA
GCTCGCCTGACCAGCGCCATAGATCTCGTCTGCACCTCTTACAAGGGGGAAGAGGGTCTTTCCCGGCTTCGCCAA
GAGTGCGCCGGCGGCAAGTCCATGGGCTTCAACGGGAAGCAGTGTATCCACCCCGATCAGCTTCAAACCGTCCAA
GCCATGTTCGCCCCTTCGAGGGAAGACGTCGAGTGGGCCGTCCGTGTCGTCATGGCCGATGAAAAGGCCACGGCC
GCCGGTCGAGGCGCCTGGACGCTCGACGGCAAAATGATCGACGCCCCCGTCGTGGGCAAGGCGCGCGCCATCGTT
TCCAAGGCCGAGAGCTGCGGCTTTGATGTGCCGGGCCTTCGTCTGCGCTGGGCAGACCAGGAGCCGGAGTGA
Gene >Ophun1|6182
ATGCTCGTCAAATCCCTCCGCCTGGCATCAGACAACATCACCTACGACCTCGAGGACTCCGTCACTCCCGCCCGT
AAGCCAGAGGCTCGTCAAGACCTCAAGGCTCATCTCGCCCGCCTCACTTGTCGCCCTCCCGCCGTCGCGGAGCTC
GCCGTTCGCGTCAACGCCGTGTCGACGCCTCACTCCATCCATGACCTCACCGTCGCAGCCTCGTCGCCCCTCGTC
GATGCAGTCGTCGTCCCCAAGGTCGAATCGGCTGAAGACGTCACCTTTGTATCTTCCGTCTTGCGCCACGTCGCG
TCCGACCGCCAAACCCAAGGCTCCCGGAACCCCATCAGCATCATCGCTCTCATTGAATCCGCCAACGCCGTCATG
AACCTCGCCGCTATATCCAAGGCCTCTCCCCACCTCGACGGCCTCATCTTTGCAGCCGAAGACTTTGCCCTCGAC
CTCTCCATCACCCGCACGCCCTCGCTGACCGAGTTCCTCTACGCCCGCTCCGCAATCGTCACCGCCGCCCGCGCA
GCTCGCCTGACCAGCGCCATAGATCTCGTCTGCACCTCTTACAAGGGGGAAGAGGGTCTTTCCCGGCTTCGCCAA
GAGTGCGCCGGCGGCAAGTCCATGGGCTTCAACGGGAAGCAGTGTATCCACCCCGATCAGCTTCAAACCGTCCAA
GCCATGTTCGCCCCTTCGAGGGAAGACGTCGAGTGGGCCGTCCGTGTCGTCATGGCCGATGAAAAGGCCACGGCC
GCCGGTCGAGGCGCCTGGACGCTCGACGGCAAAATGATCGACGCCCCCGTCGTGGGCAAGGCGCGCGCCATCGTT
TCCAAGGCCGAGAGCTGCGGCTTTGATGTGCCGGGCCTTCGTCTGCGCTGGGCAGACCAGGAGCCGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail