Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6179
Gene name
LocationContig_658:1988..2919
Strand+
Gene length (bp)931
Transcript length (bp)684
Coding sequence length (bp)684
Protein length (aa) 228

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04752 ChaC ChaC-like protein 1.3E-52 34 209

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87305|CHAC_SCHPO Glutathione-specific gamma-glutamylcyclotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC31F10.03 PE=3 SV=1 1 209 2.0E-45
sp|Q5PPV4|CHAC2_XENLA Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Xenopus laevis GN=chac2 PE=2 SV=1 8 214 5.0E-40
sp|Q4KMJ1|CHAC2_DANRE Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Danio rerio GN=chac2 PE=2 SV=1 8 214 1.0E-39
sp|Q8WUX2|CHAC2_HUMAN Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Homo sapiens GN=CHAC2 PE=2 SV=1 8 209 3.0E-39
sp|Q641Z5|CHAC2_RAT Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Rattus norvegicus GN=Chac2 PE=2 SV=1 8 209 5.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87305|CHAC_SCHPO Glutathione-specific gamma-glutamylcyclotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC31F10.03 PE=3 SV=1 1 209 2.0E-45
sp|Q5PPV4|CHAC2_XENLA Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Xenopus laevis GN=chac2 PE=2 SV=1 8 214 5.0E-40
sp|Q4KMJ1|CHAC2_DANRE Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Danio rerio GN=chac2 PE=2 SV=1 8 214 1.0E-39
sp|Q8WUX2|CHAC2_HUMAN Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Homo sapiens GN=CHAC2 PE=2 SV=1 8 209 3.0E-39
sp|Q641Z5|CHAC2_RAT Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Rattus norvegicus GN=Chac2 PE=2 SV=1 8 209 5.0E-39
sp|Q9CQG1|CHAC2_MOUSE Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Mus musculus GN=Chac2 PE=1 SV=1 8 209 7.0E-39
sp|Q5ZI66|CHAC2_CHICK Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Gallus gallus GN=chac2 PE=2 SV=1 8 204 3.0E-38
sp|P32656|CHAC_YEAST Glutathione-specific gamma-glutamylcyclotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCG1 PE=1 SV=1 1 192 5.0E-38
sp|B3STU3|CHAC1_RAT Glutathione-specific gamma-glutamylcyclotransferase 1 OS=Rattus norvegicus GN=Chac1 PE=2 SV=1 8 201 2.0E-32
sp|Q0IIH4|CHAC2_BOVIN Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Bos taurus GN=CHAC2 PE=2 SV=1 8 209 3.0E-32
sp|Q9BUX1|CHAC1_HUMAN Glutathione-specific gamma-glutamylcyclotransferase 1 OS=Homo sapiens GN=CHAC1 PE=1 SV=2 8 208 5.0E-32
sp|Q8R3J5|CHAC1_MOUSE Glutathione-specific gamma-glutamylcyclotransferase 1 OS=Mus musculus GN=Chac1 PE=1 SV=2 4 211 1.0E-31
sp|Q5SPB6|CHAC1_DANRE Glutathione-specific gamma-glutamylcyclotransferase 1 OS=Danio rerio GN=chac1 PE=3 SV=1 8 201 1.0E-30
sp|P39163|CHAC_ECOLI Glutathione-specific gamma-glutamylcyclotransferase OS=Escherichia coli (strain K12) GN=chaC PE=3 SV=3 9 201 3.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0006751 glutathione catabolic process Yes
GO:0003839 gamma-glutamylcyclotransferase activity Yes
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0006518 peptide metabolic process No
GO:0009056 catabolic process No
GO:0016829 lyase activity No
GO:0044248 cellular catabolic process No
GO:0044273 sulfur compound catabolic process No
GO:0006749 glutathione metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0016842 amidine-lyase activity No
GO:0016840 carbon-nitrogen lyase activity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0042219 cellular modified amino acid catabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:1901575 organic substance catabolic process No
GO:0043603 cellular amide metabolic process No
GO:0006575 cellular modified amino acid metabolic process No
GO:0043171 peptide catabolic process No
GO:0006790 sulfur compound metabolic process No
GO:0006807 nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5048
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|2155
Ophiocordyceps camponoti-floridani Ophcf2|00256
Ophiocordyceps camponoti-rufipedis Ophun1|6179 (this protein)
Ophiocordyceps kimflemingae Ophio5|6397
Ophiocordyceps subramaniannii Hirsu2|2703

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6179
MPSDAPDFWLYGYGYPEPPQNSSHSLTLLSPPRSLIWKPPPHFDRKVPGWVTGYVRRFWQASEDHRGTPEAPGRV
VTLIQRSYWDSLPDDHDDAPDKVWGVAYRIMPDRVAQVKDYLDIREINGYSIHYTPFHPADGSPPISTLVYIGTP
DNDQFVGPQDPDQLARHILACRGPSGLNKDYLFELEAALRDLGPGSGDLHVGDLAGRVRLLESHPPSAADDDDVQ
EP*
Coding >Ophun1|6179
ATGCCCTCCGACGCCCCCGACTTCTGGCTCTACGGCTACGGGTATCCCGAACCCCCCCAAAACTCCTCCCATTCG
CTCACTCTCCTTTCTCCTCCCAGGAGCCTCATATGGAAACCCCCGCCGCATTTCGACAGAAAGGTCCCCGGCTGG
GTCACGGGCTACGTCCGCCGCTTCTGGCAGGCCAGCGAGGATCATCGAGGTACCCCCGAGGCGCCCGGCCGTGTC
GTCACCCTCATCCAGAGATCCTACTGGGACTCCCTCCCCGATGACCACGACGACGCCCCGGATAAGGTCTGGGGC
GTCGCCTACCGCATCATGCCCGACCGTGTCGCCCAGGTCAAGGACTACCTCGATATCCGCGAGATCAACGGCTAT
TCCATCCACTACACGCCCTTTCACCCGGCCGACGGCTCTCCTCCCATCTCGACCCTCGTCTACATCGGCACCCCG
GACAACGACCAGTTCGTCGGCCCCCAGGACCCCGACCAGCTTGCCCGACACATCCTCGCCTGCCGCGGACCCAGC
GGCCTCAACAAGGATTACCTTTTCGAACTCGAGGCCGCCCTCCGAGACCTCGGCCCCGGCAGCGGCGACCTCCAT
GTCGGTGACCTCGCCGGCCGCGTCAGGCTCCTCGAGAGCCATCCACCTTCAGCCGCCGACGACGACGACGTGCAA
GAGCCTTGA
Transcript >Ophun1|6179
ATGCCCTCCGACGCCCCCGACTTCTGGCTCTACGGCTACGGGTATCCCGAACCCCCCCAAAACTCCTCCCATTCG
CTCACTCTCCTTTCTCCTCCCAGGAGCCTCATATGGAAACCCCCGCCGCATTTCGACAGAAAGGTCCCCGGCTGG
GTCACGGGCTACGTCCGCCGCTTCTGGCAGGCCAGCGAGGATCATCGAGGTACCCCCGAGGCGCCCGGCCGTGTC
GTCACCCTCATCCAGAGATCCTACTGGGACTCCCTCCCCGATGACCACGACGACGCCCCGGATAAGGTCTGGGGC
GTCGCCTACCGCATCATGCCCGACCGTGTCGCCCAGGTCAAGGACTACCTCGATATCCGCGAGATCAACGGCTAT
TCCATCCACTACACGCCCTTTCACCCGGCCGACGGCTCTCCTCCCATCTCGACCCTCGTCTACATCGGCACCCCG
GACAACGACCAGTTCGTCGGCCCCCAGGACCCCGACCAGCTTGCCCGACACATCCTCGCCTGCCGCGGACCCAGC
GGCCTCAACAAGGATTACCTTTTCGAACTCGAGGCCGCCCTCCGAGACCTCGGCCCCGGCAGCGGCGACCTCCAT
GTCGGTGACCTCGCCGGCCGCGTCAGGCTCCTCGAGAGCCATCCACCTTCAGCCGCCGACGACGACGACGTGCAA
GAGCCTTGA
Gene >Ophun1|6179
ATGCCCTCCGACGCCCCCGACTTCTGGCTCTACGGCTACGGGTATCCCGAACCCCCCCAAAACTCCTCCCATTCG
CTCACTCTCCTTTCTCCTCCCAGGAGCCTCATATGGAAACCCCCGCCGCATTTCGGTAAAGCCCCTCCCCCACAC
CCTCGATTCAGCCCTCGGTCGGTCACCTTGACAGCCGTCACTGTCAGACAGAAAGGTCCCCGGCTGGGTCACGGG
CTACGTCCGCCGCTTCTGGCAGGTCTGTCACGGCCATGGCCCTTCTGCTTCCCCCACGCCCTTGCCCACGCCCTT
ACTCACGCCCTTCTGCAGGCCAGGTATGATGGAGTCAAGACCCAAAAAACCTCGACTCAATCCCTTCCCCATTTA
TGTACTGACTCGATCTTTCTCTCTCTCTCTCTGTCTCTCTCTGTCCTCGTCTTACAGCGAGGATCATCGAGGTAC
CCCCGAGGCGCCCGGCCGTGTCGTCACCCTCATCCAGAGATCCTACTGGGACTCCCTCCCCGATGACCACGACGA
CGCCCCGGATAAGGTCTGGGGCGTCGCCTACCGCATCATGCCCGACCGTGTCGCCCAGGTCAAGGACTACCTCGA
TATCCGCGAGATCAACGGCTATTCCATCCACTACACGCCCTTTCACCCGGCCGACGGCTCTCCTCCCATCTCGAC
CCTCGTCTACATCGGCACCCCGGACAACGACCAGTTCGTCGGCCCCCAGGACCCCGACCAGCTTGCCCGACACAT
CCTCGCCTGCCGCGGACCCAGCGGCCTCAACAAGGATTACCTTTTCGAACTCGAGGCCGCCCTCCGAGACCTCGG
CCCCGGCAGCGGCGACCTCCATGTCGGTGACCTCGCCGGCCGCGTCAGGCTCCTCGAGAGCCATCCACCTTCAGC
CGCCGACGACGACGACGTGCAAGAGCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail