Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6177
Gene name
LocationContig_657:7837..9495
Strand-
Gene length (bp)1658
Transcript length (bp)1437
Coding sequence length (bp)1437
Protein length (aa) 479

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01399 PCI PCI domain 2.6E-09 347 469

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SD63|CSN12_NEUCR Protein CSN12 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-8 PE=3 SV=2 1 478 0.0E+00
sp|Q4IMN9|CSN12_GIBZE Protein CSN12 homolog OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CSN12 PE=3 SV=2 1 478 0.0E+00
sp|Q4WJX0|CSN12_ASPFU Protein CSN12 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=csn12 PE=3 SV=1 1 478 1.0E-152
sp|O13873|CSN12_SCHPO Protein CSN12 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csn12 PE=3 SV=1 148 474 8.0E-67
sp|Q4P8T5|CSN12_USTMA Protein CSN12 homolog OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CSN12 PE=3 SV=1 122 475 3.0E-57
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SD63|CSN12_NEUCR Protein CSN12 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-8 PE=3 SV=2 1 478 0.0E+00
sp|Q4IMN9|CSN12_GIBZE Protein CSN12 homolog OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CSN12 PE=3 SV=2 1 478 0.0E+00
sp|Q4WJX0|CSN12_ASPFU Protein CSN12 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=csn12 PE=3 SV=1 1 478 1.0E-152
sp|O13873|CSN12_SCHPO Protein CSN12 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csn12 PE=3 SV=1 148 474 8.0E-67
sp|Q4P8T5|CSN12_USTMA Protein CSN12 homolog OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CSN12 PE=3 SV=1 122 475 3.0E-57
sp|Q6C1L4|CSN12_YARLI Protein CSN12 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CSN12 PE=3 SV=1 146 474 8.0E-47
sp|P0CR48|CSN12_CRYNJ Protein CSN12 homolog OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CSN12 PE=3 SV=1 120 474 6.0E-46
sp|P0CR49|CSN12_CRYNB Protein CSN12 homolog OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CSN12 PE=3 SV=1 120 474 6.0E-46
sp|Q5JVF3|PCID2_HUMAN PCI domain-containing protein 2 OS=Homo sapiens GN=PCID2 PE=1 SV=2 105 474 7.0E-41
sp|Q8BFV2|PCID2_MOUSE PCI domain-containing protein 2 OS=Mus musculus GN=Pcid2 PE=1 SV=1 105 474 1.0E-37
sp|Q5FWP8|PCID2_XENLA PCI domain-containing protein 2 OS=Xenopus laevis GN=pcid2 PE=2 SV=1 105 474 1.0E-37
sp|Q5U3P0|PCID2_DANRE PCI domain-containing protein 2 OS=Danio rerio GN=pcid2 PE=2 SV=1 120 474 7.0E-35
sp|Q2TBN6|PCID2_BOVIN PCI domain-containing protein 2 OS=Bos taurus GN=PCID2 PE=2 SV=1 105 474 2.0E-34
sp|Q54PX7|PCID2_DICDI PCI domain-containing protein 2 homolog OS=Dictyostelium discoideum GN=pcid2 PE=3 SV=1 204 474 3.0E-33
sp|Q8GWE6|EER5_ARATH Enhanced ethylene response protein 5 OS=Arabidopsis thaliana GN=EER5 PE=1 SV=1 119 474 1.0E-30
sp|Q9VTL1|PCID2_DROME PCI domain-containing protein 2 homolog OS=Drosophila melanogaster GN=PCID2 PE=1 SV=2 120 478 1.0E-30
sp|Q75BU2|CSN12_ASHGO COP9 signalosome complex subunit 12 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSN12 PE=3 SV=2 190 474 2.0E-23
sp|Q9Y820|YON7_SCHPO PCI domain-containing protein C1105.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1105.07c PE=4 SV=1 178 473 3.0E-23
sp|Q95QU0|PCID2_CAEEL PCI domain-containing protein 2 homolog OS=Caenorhabditis elegans GN=C27F2.10 PE=3 SV=1 211 474 4.0E-22
sp|Q60YJ7|PCID2_CAEBR PCI domain-containing protein 2 homolog OS=Caenorhabditis briggsae GN=CBG18211 PE=3 SV=1 211 474 1.0E-21
sp|Q6CPB1|CSN12_KLULA COP9 signalosome complex subunit 12 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CSN12 PE=3 SV=1 133 475 9.0E-21
sp|Q6BGR7|CSN12_DEBHA Protein CSN12 homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CSN12 PE=3 SV=2 208 475 4.0E-19
sp|P47130|CSN12_YEAST Cop9 signalosome complex subunit 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSN12 PE=1 SV=1 197 476 2.0E-16
sp|Q08231|THP1_YEAST Nuclear mRNA export protein THP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THP1 PE=1 SV=1 226 397 6.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2025
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4667
Ophiocordyceps australis map64 (Brazil) OphauB2|4509
Ophiocordyceps camponoti-floridani Ophcf2|03297
Ophiocordyceps camponoti-rufipedis Ophun1|6177 (this protein)
Ophiocordyceps kimflemingae Ophio5|3540
Ophiocordyceps subramaniannii Hirsu2|2289

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6177
MNHLFDSFALAYDAKNGYSLAQTLTPVAPPDDPGLLVRIYNSTNAQNAKSDILHYVKNQAAYFKDFGHDEINGWV
EVYYAYWKALGEIVAGENGKVSYSDVRLHEMFAEMKLTEDAQSSWTDTYEAWKALCSVLIRGYNNCGFKAWTIPT
LYLVGKYLKAFAIKSDEERARTGFVPSTRVSYFQDDFDPEMQEQAQLRDCEQHLKRMFTLCLNDRAPLEESRKWG
IYYIINLLFKTYFKLNSASLSMTILKTLAVYNDKGDMPALEKFPKSERVTFRFYEGLLYFLEEHYDQAEKSLFEA
WQLCHKDAKTNLERILTYLVPCRLITSHILPSKELLEPYPRLQEIFLPLSKSIRRGDLGGFYKALEEAEPELVKR
RIYLTLERGHDIAFRNLLRKVFLAGGYDEPKEGDTAPVRRTRIPIGEFVAAVQMSTGDETWVRERVELLMCNIIY
KDLMKGYISRERGIVVLSKKGAFPGTGV*
Coding >Ophun1|6177
ATGAATCACCTCTTTGATTCGTTCGCCCTCGCGTACGACGCCAAAAACGGCTATTCGCTCGCGCAGACTCTCACT
CCAGTTGCGCCGCCTGATGACCCTGGCCTGCTGGTGAGGATCTATAACAGCACGAACGCTCAGAACGCCAAGTCA
GACATCCTGCACTACGTCAAGAATCAGGCAGCCTATTTCAAAGACTTCGGCCATGACGAAATCAACGGCTGGGTC
GAAGTTTATTACGCCTACTGGAAAGCCCTCGGCGAGATCGTTGCTGGGGAAAACGGAAAGGTCAGCTACAGCGAC
GTCAGACTCCACGAGATGTTCGCCGAAATGAAGCTGACCGAAGACGCTCAGTCGTCGTGGACTGATACTTACGAG
GCCTGGAAAGCCCTCTGCTCCGTCTTGATCCGCGGTTACAACAACTGCGGATTCAAAGCCTGGACCATTCCCACC
TTGTATTTGGTGGGCAAGTATCTCAAGGCTTTCGCCATCAAGTCGGATGAGGAACGTGCTCGTACCGGCTTTGTC
CCTTCAACCCGAGTCTCCTACTTTCAGGACGACTTCGACCCGGAGATGCAGGAGCAGGCGCAGCTCAGGGACTGT
GAGCAGCATCTCAAACGCATGTTCACGCTATGCCTCAATGATAGAGCGCCTTTGGAAGAGTCTCGCAAATGGGGG
ATCTACTACATCATTAACCTCCTCTTCAAGACTTACTTCAAACTAAACTCGGCCTCCTTGTCCATGACCATCCTC
AAGACTTTGGCCGTCTACAATGACAAGGGGGATATGCCTGCGCTCGAAAAATTTCCTAAGAGCGAGAGAGTGACG
TTCAGATTCTACGAAGGTCTTCTCTATTTCCTCGAGGAGCATTATGACCAGGCTGAAAAGAGTCTCTTCGAGGCT
TGGCAACTCTGCCACAAGGACGCCAAAACAAACTTGGAGCGCATCTTGACGTATCTTGTCCCTTGCAGATTGATC
ACGAGCCACATCCTCCCATCGAAGGAGCTGCTCGAGCCGTATCCTCGTCTTCAGGAAATCTTTTTGCCGCTGTCG
AAGAGCATTAGACGCGGCGATCTTGGGGGCTTCTACAAGGCGCTGGAGGAGGCCGAGCCCGAGCTCGTCAAACGA
CGCATCTACTTGACGCTTGAGCGTGGTCACGATATTGCATTCCGCAACCTTTTGCGCAAAGTCTTCCTCGCTGGG
GGATACGACGAACCCAAGGAAGGGGATACAGCTCCAGTGCGTCGGACTCGCATTCCCATTGGCGAGTTTGTGGCG
GCCGTGCAAATGAGCACCGGCGACGAGACTTGGGTCCGCGAGCGCGTGGAACTCCTCATGTGCAACATAATTTAC
AAGGATCTCATGAAGGGCTACATTTCACGCGAGCGAGGTATTGTCGTGCTGTCCAAGAAAGGTGCCTTTCCGGGC
ACTGGAGTTTAG
Transcript >Ophun1|6177
ATGAATCACCTCTTTGATTCGTTCGCCCTCGCGTACGACGCCAAAAACGGCTATTCGCTCGCGCAGACTCTCACT
CCAGTTGCGCCGCCTGATGACCCTGGCCTGCTGGTGAGGATCTATAACAGCACGAACGCTCAGAACGCCAAGTCA
GACATCCTGCACTACGTCAAGAATCAGGCAGCCTATTTCAAAGACTTCGGCCATGACGAAATCAACGGCTGGGTC
GAAGTTTATTACGCCTACTGGAAAGCCCTCGGCGAGATCGTTGCTGGGGAAAACGGAAAGGTCAGCTACAGCGAC
GTCAGACTCCACGAGATGTTCGCCGAAATGAAGCTGACCGAAGACGCTCAGTCGTCGTGGACTGATACTTACGAG
GCCTGGAAAGCCCTCTGCTCCGTCTTGATCCGCGGTTACAACAACTGCGGATTCAAAGCCTGGACCATTCCCACC
TTGTATTTGGTGGGCAAGTATCTCAAGGCTTTCGCCATCAAGTCGGATGAGGAACGTGCTCGTACCGGCTTTGTC
CCTTCAACCCGAGTCTCCTACTTTCAGGACGACTTCGACCCGGAGATGCAGGAGCAGGCGCAGCTCAGGGACTGT
GAGCAGCATCTCAAACGCATGTTCACGCTATGCCTCAATGATAGAGCGCCTTTGGAAGAGTCTCGCAAATGGGGG
ATCTACTACATCATTAACCTCCTCTTCAAGACTTACTTCAAACTAAACTCGGCCTCCTTGTCCATGACCATCCTC
AAGACTTTGGCCGTCTACAATGACAAGGGGGATATGCCTGCGCTCGAAAAATTTCCTAAGAGCGAGAGAGTGACG
TTCAGATTCTACGAAGGTCTTCTCTATTTCCTCGAGGAGCATTATGACCAGGCTGAAAAGAGTCTCTTCGAGGCT
TGGCAACTCTGCCACAAGGACGCCAAAACAAACTTGGAGCGCATCTTGACGTATCTTGTCCCTTGCAGATTGATC
ACGAGCCACATCCTCCCATCGAAGGAGCTGCTCGAGCCGTATCCTCGTCTTCAGGAAATCTTTTTGCCGCTGTCG
AAGAGCATTAGACGCGGCGATCTTGGGGGCTTCTACAAGGCGCTGGAGGAGGCCGAGCCCGAGCTCGTCAAACGA
CGCATCTACTTGACGCTTGAGCGTGGTCACGATATTGCATTCCGCAACCTTTTGCGCAAAGTCTTCCTCGCTGGG
GGATACGACGAACCCAAGGAAGGGGATACAGCTCCAGTGCGTCGGACTCGCATTCCCATTGGCGAGTTTGTGGCG
GCCGTGCAAATGAGCACCGGCGACGAGACTTGGGTCCGCGAGCGCGTGGAACTCCTCATGTGCAACATAATTTAC
AAGGATCTCATGAAGGGCTACATTTCACGCGAGCGAGGTATTGTCGTGCTGTCCAAGAAAGGTGCCTTTCCGGGC
ACTGGAGTTTAG
Gene >Ophun1|6177
ATGAATCACCTCTTTGATTCGTTCGCCCTCGCGTACGACGCCAAAAACGGCTATTCGCTCGCGCAGACTCTCACT
CCAGTTGCGCCGCCTGATGACCCTGGCCTGCTGGTGAGGATCTATAACAGCACGAACGCTCAGAACGCCAAGTCA
GACATCCTGCACTACGTCAAGAATCAGGCAGCCTATTTCAAAGACTTCGGCCATGACGAAATCAACGGCTGGGTC
GAAGTTTATTACGCCTACTGGAAAGCCCTCGGCGAGATCGTTGCTGGGGAAAACGGAAAGGTCAGCTACAGCGAC
GTCAGACTCCACGAGATGTTCGCCGAAATGAAGCTGACCGAAGACGCTCAGTCGTCGTGGACTGATACTTACGAG
GCCTGGAAAGCCCTCTGCTCCGTCTTGATCCGCGGTTACAACAACTGCGGATTCAAAGCCTGGACCATTCCCACC
TTGTATTTGGTGGGCAAGTATCTCAAGGCTTTCGCCATCAAGTCGGATGAGGAACGTGCTCGTACCGGCTTTGTC
CCTTCAACCCGAGTCTCCTACTTTCAGGACGACTTCGACCCGGAGATGCAGGAGCAGGCGCAGCTCAGGGACTGT
GAGCAGCATCTCAAACGCATGTTCACGCTATGCCTCAATGATAGGTAAGCTACTTCTCCGCCGAATGCACCGACC
CAGCTGACCATGAATTCAGAGCGCCTTTGGAAGAGTCTCGCAAATGGGGGATCTACTACATCATTAACCTCCTCT
TCAAGACTTACTTCAAACTAAACTCGGCCTCCTTGTCCATGACCATCCTCAAGACTTTGGCCGTCTACAATGACA
AGGGGGATATGCCTGCGCTCGAAAAATTTCCTAAGAGCGAGAGAGTGACGTTCAGATTCTACGAAGGTCTTCTCT
ATTTCCTCGAGGAGCATTATGACCAGGTATGCACCCCTTCTTCCGCTCTCTAGGAGAGCTGTGATTGCTGACGCC
TTTACGCAGGCTGAAAAGAGTCTCTTCGAGGCTTGGCAACTCTGCCACAAGGACGCCAAAACAAACTTGGAGTGA
GTTTGACTCGAGACATGAGATTGAAAAGACCCGCTGCTGACAGTATTCCAGGCGCATCTTGACGTATCTTGTCCC
TTGCAGATTGATCACGAGCCACATCCTCCCATCGAAGGAGCTGCTCGAGCCGTATCCTCGTCTTCAGGAAATCTT
TTTGCCGCTGTCGAAGAGCATTAGACGCGGCGATCTTGGGGGCTTCTACAAGGCGCTGGAGGAGGCCGAGCCCGA
GCTCGTCAAACGACGCATCTACTTGACGCTTGAGCGTGGTCACGATATTGCATTCCGCAACCTTTTGCGCAAAGT
CTTCCTCGCTGGGGGATACGACGAACCCAAGGAAGGGGATACAGCTCCAGTGCGTCGGACTCGCATTCCCATTGG
CGAGTTTGTGGCGGCCGTGCAAATGAGCACCGGCGACGAGACTTGGGTCCGCGAGCGCGTGGAACTCCTCATGTG
CAACATAATTTACAAGGTAAGAGAGAGAGTCTTTTTTCATGGGTTGTCGGTTGCTGACGAGTAACGCCATGCAGG
ATCTCATGAAGGGCTACATTTCACGCGAGCGAGGTATTGTCGTGCTGTCCAAGAAAGGTGCCTTTCCGGGCACTG
GAGTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail