Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6176
Gene name
LocationContig_657:6027..6987
Strand+
Gene length (bp)960
Transcript length (bp)840
Coding sequence length (bp)840
Protein length (aa) 280

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00651 BTB BTB/POZ domain 5.1E-08 73 134

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup318
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4668
Ophiocordyceps australis map64 (Brazil) OphauB2|4508
Ophiocordyceps camponoti-floridani Ophcf2|03298
Ophiocordyceps camponoti-floridani Ophcf2|04570
Ophiocordyceps camponoti-rufipedis Ophun1|2502
Ophiocordyceps camponoti-rufipedis Ophun1|6176 (this protein)
Ophiocordyceps kimflemingae Ophio5|3539
Ophiocordyceps kimflemingae Ophio5|7149
Ophiocordyceps subramaniannii Hirsu2|2290
Ophiocordyceps subramaniannii Hirsu2|3753

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6176
MLKTQFGTSGRSFSSKGKSKKLIKAGSSFSREGGVSKKRVEGRSRRLAASNAASDDAASSPAADGTQASSAIVTL
VVGAEQRLFAAHESILCASPFFLTLLQSAYPQPAMKRVSLPDEEPDIFSAVLEYLYKGDYFPRLKHNKRCNSWEL
EPASDEERASVESTVYHRGVDGELLKDTVIYCAALRYGLDELKRLALRKQGLQSGIQCSTILASARYAYANTPDH
DSKLRAHYLALIIRSRSTFKRSGTLQLEMYNGGTQLFFDLFVAMCNHIDDVSSA*
Coding >Ophun1|6176
ATGCTCAAAACACAGTTTGGCACGTCGGGTCGAAGCTTTTCGTCCAAGGGGAAGAGCAAGAAGCTTATCAAGGCG
GGCTCGTCTTTCAGTCGTGAGGGCGGCGTTTCGAAGAAGAGGGTTGAGGGTCGGTCGCGGAGGCTGGCTGCGTCG
AATGCTGCCAGTGACGATGCTGCTTCTTCTCCTGCCGCGGATGGTACGCAAGCATCATCCGCCATCGTGACGCTC
GTCGTCGGCGCCGAACAACGCCTCTTCGCCGCTCACGAATCCATCCTCTGCGCAAGCCCCTTCTTCCTCACCCTT
TTGCAGAGCGCCTACCCACAGCCCGCCATGAAGCGCGTCTCCCTTCCGGATGAGGAGCCGGATATCTTCAGTGCG
GTTCTCGAATATCTTTACAAGGGCGACTACTTCCCCCGTCTCAAGCACAATAAGCGGTGCAACTCGTGGGAGCTG
GAGCCTGCCTCGGATGAGGAGCGGGCTTCGGTTGAGAGTACCGTCTATCACCGCGGTGTGGATGGCGAACTCCTC
AAGGATACTGTCATCTACTGCGCCGCCTTGAGATACGGTCTCGACGAGCTCAAGAGGCTTGCGCTACGGAAGCAG
GGTCTTCAATCTGGTATCCAGTGCAGCACCATCTTAGCCTCTGCTCGATACGCCTACGCCAATACCCCCGATCAC
GACTCCAAGCTACGAGCACACTACCTCGCCCTCATCATCCGTTCCCGCTCAACCTTCAAGCGAAGCGGCACCCTT
CAGCTCGAGATGTACAACGGCGGCACGCAGCTCTTCTTCGACCTCTTCGTCGCCATGTGCAACCACATCGACGAC
GTATCGTCCGCTTAG
Transcript >Ophun1|6176
ATGCTCAAAACACAGTTTGGCACGTCGGGTCGAAGCTTTTCGTCCAAGGGGAAGAGCAAGAAGCTTATCAAGGCG
GGCTCGTCTTTCAGTCGTGAGGGCGGCGTTTCGAAGAAGAGGGTTGAGGGTCGGTCGCGGAGGCTGGCTGCGTCG
AATGCTGCCAGTGACGATGCTGCTTCTTCTCCTGCCGCGGATGGTACGCAAGCATCATCCGCCATCGTGACGCTC
GTCGTCGGCGCCGAACAACGCCTCTTCGCCGCTCACGAATCCATCCTCTGCGCAAGCCCCTTCTTCCTCACCCTT
TTGCAGAGCGCCTACCCACAGCCCGCCATGAAGCGCGTCTCCCTTCCGGATGAGGAGCCGGATATCTTCAGTGCG
GTTCTCGAATATCTTTACAAGGGCGACTACTTCCCCCGTCTCAAGCACAATAAGCGGTGCAACTCGTGGGAGCTG
GAGCCTGCCTCGGATGAGGAGCGGGCTTCGGTTGAGAGTACCGTCTATCACCGCGGTGTGGATGGCGAACTCCTC
AAGGATACTGTCATCTACTGCGCCGCCTTGAGATACGGTCTCGACGAGCTCAAGAGGCTTGCGCTACGGAAGCAG
GGTCTTCAATCTGGTATCCAGTGCAGCACCATCTTAGCCTCTGCTCGATACGCCTACGCCAATACCCCCGATCAC
GACTCCAAGCTACGAGCACACTACCTCGCCCTCATCATCCGTTCCCGCTCAACCTTCAAGCGAAGCGGCACCCTT
CAGCTCGAGATGTACAACGGCGGCACGCAGCTCTTCTTCGACCTCTTCGTCGCCATGTGCAACCACATCGACGAC
GTATCGTCCGCTTAG
Gene >Ophun1|6176
ATGCTCAAAACACAGTTTGGCACGTCGGGTCGAAGCTTTTCGTCCAAGGGGAAGAGCAAGAAGCTTATCAAGGCG
GGCTCGTCTTTCAGTCGTGAGGGCGGCGTTTCGAAGAAGAGGGTTGAGGGTCGGTCGCGGAGGCTGGCTGCGTCG
AATGCTGCCAGTGACGATGCTGCTTCTTCTCCTGCCGCGGATGGGTGAGGCAACTGACAATCTTTATTTGCCTAG
ATGTCTTGGCTTATTGTTCTCGTGCAGTACGCAAGCATCATCCGCCATCGTGACGCTCGTCGTCGGCGCCGAACA
ACGCCTCTTCGCCGCTCACGAATCCATCCTCTGCGCAAGCCCCTTCTTCCTCACCCTTTTGCAGAGCGCCTACCC
ACAGCCCGCCATGAAGCGCGTCTCCCTTCCGGATGAGGAGCCGGATATCTTCAGTGCGGTTCTCGAATATCTTTA
CAAGGGCGACTACTTCCCCCGTCTCAAGCACAATAAGCGGTGCAACTCGTGGGAGCTGGAGCCTGCCTCGGATGA
GGAGCGGGCTTCGGTTGAGAGTACCGTCTATCACCGCGGTGTGGATGGCGAACTCCTCAAGGATACTGTCATCTA
CTGCGCCGCCTTGAGATACGGTCTCGACGAGCTCAAGAGGCTTGCGCTACGGAAGCAGGGTCTTCGTTCGTCTCT
CCGTCCCCCCTCCCTTTACCGTGGGCATTTGGAACTGACGCTGAGTTATTAGAATCTGGTATCCAGTGCAGCACC
ATCTTAGCCTCTGCTCGATACGCCTACGCCAATACCCCCGATCACGACTCCAAGCTACGAGCACACTACCTCGCC
CTCATCATCCGTTCCCGCTCAACCTTCAAGCGAAGCGGCACCCTTCAGCTCGAGATGTACAACGGCGGCACGCAG
CTCTTCTTCGACCTCTTCGTCGCCATGTGCAACCACATCGACGACGTATCGTCCGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail