Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6174
Gene name
LocationContig_657:2629..3796
Strand-
Gene length (bp)1167
Transcript length (bp)1167
Coding sequence length (bp)1167
Protein length (aa) 389

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12799 LRR_4 Leucine Rich repeats (2 copies) 3.0E-08 235 276
PF12799 LRR_4 Leucine Rich repeats (2 copies) 1.8E-08 280 320
PF12799 LRR_4 Leucine Rich repeats (2 copies) 1.9E-07 301 340
PF13855 LRR_8 Leucine rich repeat 4.8E-07 126 181
PF13516 LRR_6 Leucine Rich repeat 1.0E-01 167 181
PF13516 LRR_6 Leucine Rich repeat 4.1E-02 300 319

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22194|SDS22_SCHPO Protein phosphatase 1 regulatory subunit SDS22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sds22 PE=1 SV=2 109 386 8.0E-91
sp|Q15435|PP1R7_HUMAN Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens GN=PPP1R7 PE=1 SV=1 99 386 2.0E-76
sp|Q5RFS7|PP1R7_PONAB Protein phosphatase 1 regulatory subunit 7 OS=Pongo abelii GN=PPP1R7 PE=2 SV=1 99 386 3.0E-76
sp|Q5HZV9|PP1R7_RAT Protein phosphatase 1 regulatory subunit 7 OS=Rattus norvegicus GN=Ppp1r7 PE=1 SV=1 68 386 3.0E-76
sp|Q3UM45|PP1R7_MOUSE Protein phosphatase 1 regulatory subunit 7 OS=Mus musculus GN=Ppp1r7 PE=1 SV=2 99 386 4.0E-76
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22194|SDS22_SCHPO Protein phosphatase 1 regulatory subunit SDS22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sds22 PE=1 SV=2 109 386 8.0E-91
sp|Q15435|PP1R7_HUMAN Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens GN=PPP1R7 PE=1 SV=1 99 386 2.0E-76
sp|Q5RFS7|PP1R7_PONAB Protein phosphatase 1 regulatory subunit 7 OS=Pongo abelii GN=PPP1R7 PE=2 SV=1 99 386 3.0E-76
sp|Q5HZV9|PP1R7_RAT Protein phosphatase 1 regulatory subunit 7 OS=Rattus norvegicus GN=Ppp1r7 PE=1 SV=1 68 386 3.0E-76
sp|Q3UM45|PP1R7_MOUSE Protein phosphatase 1 regulatory subunit 7 OS=Mus musculus GN=Ppp1r7 PE=1 SV=2 99 386 4.0E-76
sp|Q3T0W4|PP1R7_BOVIN Protein phosphatase 1 regulatory subunit 7 OS=Bos taurus GN=PPP1R7 PE=1 SV=1 97 386 3.0E-74
sp|Q32PL1|PP1R7_DANRE Protein phosphatase 1 regulatory subunit 7 OS=Danio rerio GN=ppp1r7 PE=2 SV=1 82 386 4.0E-67
sp|Q6DIQ3|PP1R7_XENTR Protein phosphatase 1 regulatory subunit 7 OS=Xenopus tropicalis GN=ppp1r7 PE=2 SV=1 99 386 5.0E-67
sp|P36047|SDS22_YEAST Protein phosphatase 1 regulatory subunit SDS22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDS22 PE=1 SV=1 82 386 1.0E-62
sp|P45969|SDS22_CAEEL Protein phosphatase 1 regulatory subunit SDS22 homolog OS=Caenorhabditis elegans GN=sds-22 PE=3 SV=1 86 386 2.0E-58
sp|Q54Q39|PP1R7_DICDI Protein phosphatase 1 regulatory subunit pprA OS=Dictyostelium discoideum GN=pprA PE=3 SV=1 107 386 3.0E-56
sp|P0DJM0|INLA_LISMO Internalin-A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlA PE=1 SV=1 79 349 4.0E-24
sp|G2K3G6|INLA_LISM4 Internalin-A OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=inlA PE=3 SV=1 79 349 4.0E-24
sp|Q723K6|INLA_LISMF Internalin-A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlA PE=3 SV=1 79 349 6.0E-24
sp|G2K3G6|INLA_LISM4 Internalin-A OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=inlA PE=3 SV=1 61 346 1.0E-22
sp|Q723K6|INLA_LISMF Internalin-A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlA PE=3 SV=1 61 346 7.0E-22
sp|P0DJM0|INLA_LISMO Internalin-A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlA PE=1 SV=1 61 346 8.0E-22
sp|P0DJM0|INLA_LISMO Internalin-A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlA PE=1 SV=1 107 308 5.0E-21
sp|G2K3G6|INLA_LISM4 Internalin-A OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=inlA PE=3 SV=1 107 308 6.0E-21
sp|P0DJM0|INLA_LISMO Internalin-A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlA PE=1 SV=1 120 328 7.0E-21
sp|Q723K6|INLA_LISMF Internalin-A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlA PE=3 SV=1 107 308 8.0E-21
sp|Q723K6|INLA_LISMF Internalin-A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlA PE=3 SV=1 120 328 1.0E-20
sp|Q8CDN9|LRRC9_MOUSE Leucine-rich repeat-containing protein 9 OS=Mus musculus GN=Lrrc9 PE=1 SV=2 115 385 1.0E-17
sp|Q8YA32|INLI_LISMO Internalin-I OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlI PE=3 SV=1 107 345 1.0E-17
sp|Q91YK0|LRC49_MOUSE Leucine-rich repeat-containing protein 49 OS=Mus musculus GN=Lrrc49 PE=1 SV=1 162 387 3.0E-17
sp|Q9D5S7|LRGUK_MOUSE Leucine-rich repeat and guanylate kinase domain-containing protein OS=Mus musculus GN=Lrguk PE=1 SV=1 144 316 4.0E-17
sp|Q8IUZ0|LRC49_HUMAN Leucine-rich repeat-containing protein 49 OS=Homo sapiens GN=LRRC49 PE=2 SV=2 201 387 4.0E-16
sp|Q723X5|INLI_LISMF Internalin-I OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlI PE=3 SV=1 159 331 4.0E-16
sp|Q723X5|INLI_LISMF Internalin-I OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlI PE=3 SV=1 136 346 5.0E-16
sp|Q6ZRR7|LRRC9_HUMAN Leucine-rich repeat-containing protein 9 OS=Homo sapiens GN=LRRC9 PE=2 SV=2 126 385 5.0E-16
sp|Q5PPX0|PPR42_XENLA Protein phosphatase 1 regulatory subunit 42 OS=Xenopus laevis GN=ppp1r42 PE=2 SV=1 167 375 5.0E-16
sp|Q0P5X1|LRIQ1_MOUSE Leucine-rich repeat and IQ domain-containing protein 1 OS=Mus musculus GN=Lrriq1 PE=2 SV=2 143 381 9.0E-16
sp|Q8YA32|INLI_LISMO Internalin-I OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlI PE=3 SV=1 136 341 1.0E-15
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 126 362 1.0E-15
sp|Q8YA32|INLI_LISMO Internalin-I OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlI PE=3 SV=1 159 331 2.0E-15
sp|Q723X5|INLI_LISMF Internalin-I OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlI PE=3 SV=1 115 361 4.0E-15
sp|Q723X5|INLI_LISMF Internalin-I OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlI PE=3 SV=1 110 359 4.0E-15
sp|P25147|INLB_LISMO Internalin B OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlB PE=1 SV=2 146 308 4.0E-15
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 126 351 4.0E-15
sp|Q8YA32|INLI_LISMO Internalin-I OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlI PE=3 SV=1 110 359 5.0E-15
sp|Q8YA32|INLI_LISMO Internalin-I OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlI PE=3 SV=1 149 344 2.0E-14
sp|Q4R803|PPR42_MACFA Protein phosphatase 1 regulatory subunit 42 OS=Macaca fascicularis GN=PPP1R42 PE=2 SV=1 168 385 2.0E-14
sp|Q8YA32|INLI_LISMO Internalin-I OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlI PE=3 SV=1 115 341 3.0E-14
sp|Q96M69|LRGUK_HUMAN Leucine-rich repeat and guanylate kinase domain-containing protein OS=Homo sapiens GN=LRGUK PE=2 SV=1 145 362 3.0E-14
sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 149 340 3.0E-14
sp|Q91YK0|LRC49_MOUSE Leucine-rich repeat-containing protein 49 OS=Mus musculus GN=Lrrc49 PE=1 SV=1 110 256 5.0E-14
sp|Q723X5|INLI_LISMF Internalin-I OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlI PE=3 SV=1 149 344 9.0E-14
sp|Q91YK0|LRC49_MOUSE Leucine-rich repeat-containing protein 49 OS=Mus musculus GN=Lrrc49 PE=1 SV=1 149 297 2.0E-13
sp|O74473|CDC11_SCHPO Septation initiation network scaffold protein cdc11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc11 PE=1 SV=1 138 295 2.0E-13
sp|Q9XHH2|DNAL1_CHLRE Dynein light chain 1, axonemal OS=Chlamydomonas reinhardtii GN=LC1 PE=1 SV=1 168 284 2.0E-13
sp|Q8IUZ0|LRC49_HUMAN Leucine-rich repeat-containing protein 49 OS=Homo sapiens GN=LRRC49 PE=2 SV=2 110 256 4.0E-13
sp|Q2KID4|DNAL1_BOVIN Dynein light chain 1, axonemal OS=Bos taurus GN=DNAL1 PE=2 SV=1 231 362 4.0E-13
sp|A8IVX2|DRC3_CHLRE Dynein regulatory complex subunit 3 OS=Chlamydomonas reinhardtii GN=DRC3 PE=1 SV=1 135 257 5.0E-13
sp|Q6GQN5|PPR42_DANRE Protein phosphatase 1 regulatory subunit 42 OS=Danio rerio GN=ppp1r42 PE=2 SV=1 166 374 6.0E-13
sp|Q4LDG9|DNAL1_HUMAN Dynein light chain 1, axonemal OS=Homo sapiens GN=DNAL1 PE=1 SV=1 231 362 6.0E-13
sp|Q05A62|DNAL1_MOUSE Dynein light chain 1, axonemal OS=Mus musculus GN=Dnal1 PE=1 SV=2 230 362 9.0E-13
sp|A0JM56|LRRC9_XENTR Leucine-rich repeat-containing protein 9 OS=Xenopus tropicalis GN=lrrc9 PE=2 SV=2 169 385 1.0E-12
sp|Q9XHH2|DNAL1_CHLRE Dynein light chain 1, axonemal OS=Chlamydomonas reinhardtii GN=LC1 PE=1 SV=1 231 385 3.0E-12
sp|Q8T888|DNAL1_CIOIN Dynein light chain 1, axonemal OS=Ciona intestinalis GN=DNAL1 PE=2 SV=1 238 386 3.0E-12
sp|Q9CZ62|CEP97_MOUSE Centrosomal protein of 97 kDa OS=Mus musculus GN=Cep97 PE=1 SV=1 217 328 5.0E-12
sp|Q7Z4L9|PPR42_HUMAN Protein phosphatase 1 regulatory subunit 42 OS=Homo sapiens GN=PPP1R42 PE=2 SV=2 168 385 6.0E-12
sp|F4IIU4|AIR9_ARATH 187-kDa microtubule-associated protein AIR9 OS=Arabidopsis thaliana GN=AIR9 PE=1 SV=1 128 282 7.0E-12
sp|Q8IW35|CEP97_HUMAN Centrosomal protein of 97 kDa OS=Homo sapiens GN=CEP97 PE=1 SV=1 217 384 9.0E-12
sp|Q28G94|DNAL1_XENTR Dynein light chain 1, axonemal OS=Xenopus tropicalis GN=dnal1 PE=2 SV=1 230 386 9.0E-12
sp|Q6DHB1|DNAL1_DANRE Dynein light chain 1, axonemal OS=Danio rerio GN=dnal1 PE=2 SV=1 231 362 1.0E-11
sp|Q28CU0|LRC23_XENTR Leucine-rich repeat-containing protein 23 OS=Xenopus tropicalis GN=lrrc23 PE=2 SV=1 145 384 1.0E-11
sp|Q6GQN5|PPR42_DANRE Protein phosphatase 1 regulatory subunit 42 OS=Danio rerio GN=ppp1r42 PE=2 SV=1 149 313 2.0E-11
sp|Q6P1C6|LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus GN=Lrig3 PE=1 SV=1 79 340 2.0E-11
sp|Q9H069|DRC3_HUMAN Dynein regulatory complex subunit 3 OS=Homo sapiens GN=DRC3 PE=2 SV=2 149 293 2.0E-11
sp|P25147|INLB_LISMO Internalin B OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlB PE=1 SV=2 198 338 6.0E-11
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 126 362 7.0E-11
sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 105 340 7.0E-11
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 101 335 8.0E-11
sp|Q8YA32|INLI_LISMO Internalin-I OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlI PE=3 SV=1 88 294 1.0E-10
sp|Q641R9|DNAL1_XENLA Dynein light chain 1, axonemal OS=Xenopus laevis GN=dnal1 PE=2 SV=1 230 386 1.0E-10
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 126 362 2.0E-10
sp|Q93373|LET4_CAEEL Leucine-rich repeat-containing protein let-4 OS=Caenorhabditis elegans GN=let-4 PE=2 SV=2 126 339 2.0E-10
sp|E7FE13|LGR4_DANRE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Danio rerio GN=lgr4 PE=2 SV=1 111 338 2.0E-10
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 126 374 2.0E-10
sp|Q9HBX8|LGR6_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Homo sapiens GN=LGR6 PE=1 SV=3 153 375 3.0E-10
sp|P25147|INLB_LISMO Internalin B OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlB PE=1 SV=2 136 328 4.0E-10
sp|Q2KID4|DNAL1_BOVIN Dynein light chain 1, axonemal OS=Bos taurus GN=DNAL1 PE=2 SV=1 161 300 4.0E-10
sp|Q05A62|DNAL1_MOUSE Dynein light chain 1, axonemal OS=Mus musculus GN=Dnal1 PE=1 SV=2 161 300 4.0E-10
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 126 351 4.0E-10
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 126 362 4.0E-10
sp|Q6GPJ8|CEP97_XENLA Centrosomal protein of 97 kDa OS=Xenopus laevis GN=cep97 PE=2 SV=1 210 317 4.0E-10
sp|Q3UVD5|LGR6_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Mus musculus GN=Lgr6 PE=2 SV=1 153 375 4.0E-10
sp|Q09JZ4|DAAF1_CHLRE Leucine-rich repeat-containing protein ODA7 OS=Chlamydomonas reinhardtii GN=ODA7 PE=1 SV=1 202 384 5.0E-10
sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 107 328 8.0E-10
sp|Q4LDG9|DNAL1_HUMAN Dynein light chain 1, axonemal OS=Homo sapiens GN=DNAL1 PE=1 SV=1 161 300 1.0E-09
sp|Q9H069|DRC3_HUMAN Dynein regulatory complex subunit 3 OS=Homo sapiens GN=DRC3 PE=2 SV=2 168 272 1.0E-09
sp|Q6AYH9|DAAF1_RAT Dynein assembly factor 1, axonemal OS=Rattus norvegicus GN=Dnaaf1 PE=1 SV=1 173 314 1.0E-09
sp|Q6NRC9|LRCC1_XENLA Leucine-rich repeat and coiled-coil domain-containing protein 1 OS=Xenopus laevis GN=lrrcc1 PE=2 SV=1 150 256 1.0E-09
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 162 326 1.0E-09
sp|Q9C099|LRCC1_HUMAN Leucine-rich repeat and coiled-coil domain-containing protein 1 OS=Homo sapiens GN=LRRCC1 PE=1 SV=2 129 269 1.0E-09
sp|B4P6W7|DAAF1_DROYA Dynein assembly factor 1, axonemal homolog OS=Drosophila yakuba GN=dtr PE=3 SV=1 165 385 1.0E-09
sp|Q4R6X9|DRC3_MACFA Dynein regulatory complex subunit 3 OS=Macaca fascicularis GN=DRC3 PE=2 SV=1 149 284 1.0E-09
sp|Q96M69|LRGUK_HUMAN Leucine-rich repeat and guanylate kinase domain-containing protein OS=Homo sapiens GN=LRGUK PE=2 SV=1 110 242 2.0E-09
sp|A0JM56|LRRC9_XENTR Leucine-rich repeat-containing protein 9 OS=Xenopus tropicalis GN=lrrc9 PE=2 SV=2 119 284 2.0E-09
sp|Q8T888|DNAL1_CIOIN Dynein light chain 1, axonemal OS=Ciona intestinalis GN=DNAL1 PE=2 SV=1 161 300 2.0E-09
sp|O94898|LRIG2_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens GN=LRIG2 PE=2 SV=3 131 340 2.0E-09
sp|Q4R747|LRC46_MACFA Leucine-rich repeat-containing protein 46 OS=Macaca fascicularis GN=LRRC46 PE=2 SV=1 212 314 2.0E-09
sp|Q96FV0|LRC46_HUMAN Leucine-rich repeat-containing protein 46 OS=Homo sapiens GN=LRRC46 PE=2 SV=1 212 322 2.0E-09
sp|Q28G94|DNAL1_XENTR Dynein light chain 1, axonemal OS=Xenopus tropicalis GN=dnal1 PE=2 SV=1 187 300 3.0E-09
sp|Q9D2H9|DAAF1_MOUSE Dynein assembly factor 1, axonemal OS=Mus musculus GN=Dnaaf1 PE=1 SV=1 154 314 3.0E-09
sp|O43300|LRRT2_HUMAN Leucine-rich repeat transmembrane neuronal protein 2 OS=Homo sapiens GN=LRRTM2 PE=2 SV=3 163 339 4.0E-09
sp|Q8NEP3|DAAF1_HUMAN Dynein assembly factor 1, axonemal OS=Homo sapiens GN=DNAAF1 PE=1 SV=5 173 313 4.0E-09
sp|D4A7P2|LRRT2_RAT Leucine-rich repeat transmembrane neuronal protein 2 OS=Rattus norvegicus GN=Lrrtm2 PE=1 SV=1 163 339 4.0E-09
sp|Q52KR2|LRIG2_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Mus musculus GN=Lrig2 PE=1 SV=1 98 340 4.0E-09
sp|Q8BGA3|LRRT2_MOUSE Leucine-rich repeat transmembrane neuronal protein 2 OS=Mus musculus GN=Lrrtm2 PE=2 SV=1 163 339 4.0E-09
sp|Q6UXM1|LRIG3_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Homo sapiens GN=LRIG3 PE=2 SV=1 143 338 4.0E-09
sp|Q4G017|NISCH_RAT Nischarin OS=Rattus norvegicus GN=Nisch PE=2 SV=2 93 240 5.0E-09
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 174 359 5.0E-09
sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 164 359 6.0E-09
sp|Q9DBB9|CPN2_MOUSE Carboxypeptidase N subunit 2 OS=Mus musculus GN=Cpn2 PE=1 SV=2 167 377 6.0E-09
sp|Q3SYS4|DAAF1_BOVIN Dynein assembly factor 1, axonemal OS=Bos taurus GN=DNAAF1 PE=2 SV=2 50 313 6.0E-09
sp|F1MT22|LGR5_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Bos taurus GN=LGR5 PE=3 SV=2 152 383 6.0E-09
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 117 362 7.0E-09
sp|Q7ZV84|DAAF1_DANRE Dynein assembly factor 1, axonemal OS=Danio rerio GN=dnaaf1 PE=2 SV=2 159 271 7.0E-09
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 114 339 7.0E-09
sp|Q9D5E4|DRC3_MOUSE Dynein regulatory complex subunit 3 OS=Mus musculus GN=Drc3 PE=1 SV=1 149 284 7.0E-09
sp|Q6NRC9|LRCC1_XENLA Leucine-rich repeat and coiled-coil domain-containing protein 1 OS=Xenopus laevis GN=lrrcc1 PE=2 SV=1 144 267 8.0E-09
sp|P08678|CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYR1 PE=1 SV=2 112 347 9.0E-09
sp|Q641R9|DNAL1_XENLA Dynein light chain 1, axonemal OS=Xenopus laevis GN=dnal1 PE=2 SV=1 167 300 1.0E-08
sp|Q9D5E4|DRC3_MOUSE Dynein regulatory complex subunit 3 OS=Mus musculus GN=Drc3 PE=1 SV=1 168 272 1.0E-08
sp|Q9D5E4|DRC3_MOUSE Dynein regulatory complex subunit 3 OS=Mus musculus GN=Drc3 PE=1 SV=1 200 322 1.0E-08
sp|Q9U3A0|PAN1_CAEEL P-granule-associated novel protein 1 OS=Caenorhabditis elegans GN=pan-1 PE=1 SV=1 138 365 1.0E-08
sp|Q8INT5|DAAF1_DROME Dynein assembly factor 1, axonemal homolog OS=Drosophila melanogaster GN=dtr PE=2 SV=2 174 385 1.0E-08
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 174 388 1.0E-08
sp|B6D5P3|DAAF1_PERLE Dynein assembly factor 1, axonemal OS=Peromyscus leucopus GN=Dnaaf1 PE=2 SV=1 154 314 1.0E-08
sp|Q8C031|LRC4C_MOUSE Leucine-rich repeat-containing protein 4C OS=Mus musculus GN=Lrrc4c PE=1 SV=2 122 329 1.0E-08
sp|Q9HCJ2|LRC4C_HUMAN Leucine-rich repeat-containing protein 4C OS=Homo sapiens GN=LRRC4C PE=1 SV=1 122 329 1.0E-08
sp|Q27972|CHAD_BOVIN Chondroadherin OS=Bos taurus GN=CHAD PE=1 SV=1 168 340 1.0E-08
sp|B6D5P1|DAAF1_PERPL Dynein assembly factor 1, axonemal OS=Peromyscus polionotus GN=Dnaaf1 PE=2 SV=1 154 314 1.0E-08
sp|F4IIU4|AIR9_ARATH 187-kDa microtubule-associated protein AIR9 OS=Arabidopsis thaliana GN=AIR9 PE=1 SV=1 174 343 2.0E-08
sp|Q6NRC9|LRCC1_XENLA Leucine-rich repeat and coiled-coil domain-containing protein 1 OS=Xenopus laevis GN=lrrcc1 PE=2 SV=1 198 295 2.0E-08
sp|O35125|LRC23_MOUSE Leucine-rich repeat-containing protein 23 OS=Mus musculus GN=Lrrc23 PE=1 SV=1 149 271 2.0E-08
sp|Q9Z1P4|LGR5_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Mus musculus GN=Lgr5 PE=2 SV=2 152 383 2.0E-08
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 108 336 2.0E-08
sp|Q6DHB1|DNAL1_DANRE Dynein light chain 1, axonemal OS=Danio rerio GN=dnal1 PE=2 SV=1 187 300 3.0E-08
sp|Q7PK92|DAAF1_ANOGA Dynein assembly factor 1, axonemal homolog OS=Anopheles gambiae GN=AGAP009594 PE=3 SV=2 162 286 3.0E-08
sp|Q29KL8|DAAF1_DROPS Dynein assembly factor 1, axonemal homolog OS=Drosophila pseudoobscura pseudoobscura GN=dtr PE=3 SV=2 228 385 3.0E-08
sp|B3NLX1|DAAF1_DROER Dynein assembly factor 1, axonemal homolog OS=Drosophila erecta GN=dtr PE=3 SV=1 174 385 3.0E-08
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 105 340 3.0E-08
sp|B4GT53|DAAF1_DROPE Dynein assembly factor 1, axonemal homolog OS=Drosophila persimilis GN=dtr PE=3 SV=1 228 385 3.0E-08
sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 108 336 3.0E-08
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 108 336 3.0E-08
sp|Q4R803|PPR42_MACFA Protein phosphatase 1 regulatory subunit 42 OS=Macaca fascicularis GN=PPP1R42 PE=2 SV=1 125 298 4.0E-08
sp|B6D5P6|DAAF1_PERCA Dynein assembly factor 1, axonemal OS=Peromyscus californicus GN=Dnaaf1 PE=2 SV=1 154 314 4.0E-08
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 108 336 4.0E-08
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 107 311 4.0E-08
sp|P28675|PGS2_CHICK Decorin OS=Gallus gallus GN=DCN PE=1 SV=1 169 359 4.0E-08
sp|Q4R6X9|DRC3_MACFA Dynein regulatory complex subunit 3 OS=Macaca fascicularis GN=DRC3 PE=2 SV=1 168 272 5.0E-08
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 174 339 5.0E-08
sp|A2AL36|CNTRL_MOUSE Centriolin OS=Mus musculus GN=Cntrl PE=1 SV=2 159 300 5.0E-08
sp|O74473|CDC11_SCHPO Septation initiation network scaffold protein cdc11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc11 PE=1 SV=1 49 370 6.0E-08
sp|Q7ZV84|DAAF1_DANRE Dynein assembly factor 1, axonemal OS=Danio rerio GN=dnaaf1 PE=2 SV=2 196 314 6.0E-08
sp|Q9Z2H4|LGR4_RAT Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Rattus norvegicus GN=Lgr4 PE=2 SV=2 149 306 6.0E-08
sp|Q9DE68|PGS2_COTJA Decorin OS=Coturnix coturnix japonica GN=DCN PE=2 SV=1 111 359 6.0E-08
sp|O55226|CHAD_MOUSE Chondroadherin OS=Mus musculus GN=Chad PE=2 SV=1 208 340 7.0E-08
sp|Q5XI54|DRC3_RAT Dynein regulatory complex subunit 3 OS=Rattus norvegicus GN=Drc3 PE=2 SV=1 168 264 7.0E-08
sp|A2ARI4|LGR4_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Mus musculus GN=Lgr4 PE=1 SV=1 149 306 8.0E-08
sp|B0BLW3|LGR4_XENTR Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Xenopus tropicalis GN=lgr4 PE=1 SV=1 149 340 9.0E-08
sp|P0DM44|LGR6_DANRE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Danio rerio GN=lgr6 PE=2 SV=1 152 375 9.0E-08
sp|Q54Y32|MPL3_DICDI MAP kinase phosphatase with leucine-rich repeats protein 3 OS=Dictyostelium discoideum GN=mpl3 PE=3 SV=1 114 281 9.0E-08
sp|Q6ZRR7|LRRC9_HUMAN Leucine-rich repeat-containing protein 9 OS=Homo sapiens GN=LRRC9 PE=2 SV=2 215 385 1.0E-07
sp|Q0P5X1|LRIQ1_MOUSE Leucine-rich repeat and IQ domain-containing protein 1 OS=Mus musculus GN=Lrriq1 PE=2 SV=2 228 335 1.0E-07
sp|Q8NEP3|DAAF1_HUMAN Dynein assembly factor 1, axonemal OS=Homo sapiens GN=DNAAF1 PE=1 SV=5 221 384 1.0E-07
sp|B6D5P3|DAAF1_PERLE Dynein assembly factor 1, axonemal OS=Peromyscus leucopus GN=Dnaaf1 PE=2 SV=1 221 384 1.0E-07
sp|Q7PK92|DAAF1_ANOGA Dynein assembly factor 1, axonemal homolog OS=Anopheles gambiae GN=AGAP009594 PE=3 SV=2 228 385 1.0E-07
sp|Q29KL8|DAAF1_DROPS Dynein assembly factor 1, axonemal homolog OS=Drosophila pseudoobscura pseudoobscura GN=dtr PE=3 SV=2 154 272 1.0E-07
sp|Q54Y32|MPL3_DICDI MAP kinase phosphatase with leucine-rich repeats protein 3 OS=Dictyostelium discoideum GN=mpl3 PE=3 SV=1 171 316 1.0E-07
sp|Q8CHE4|PHLP1_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Mus musculus GN=Phlpp1 PE=1 SV=2 168 386 1.0E-07
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 164 339 1.0E-07
sp|O70210|CHAD_RAT Chondroadherin OS=Rattus norvegicus GN=Chad PE=2 SV=1 208 340 1.0E-07
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 174 339 1.0E-07
sp|O75473|LGR5_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Homo sapiens GN=LGR5 PE=1 SV=1 152 383 1.0E-07
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 114 339 1.0E-07
sp|Q6ZRR7|LRRC9_HUMAN Leucine-rich repeat-containing protein 9 OS=Homo sapiens GN=LRRC9 PE=2 SV=2 151 386 2.0E-07
sp|Q28CU0|LRC23_XENTR Leucine-rich repeat-containing protein 23 OS=Xenopus tropicalis GN=lrrc23 PE=2 SV=1 109 267 2.0E-07
sp|Q9HBX8|LGR6_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Homo sapiens GN=LGR6 PE=1 SV=3 147 351 2.0E-07
sp|Q4R6X9|DRC3_MACFA Dynein regulatory complex subunit 3 OS=Macaca fascicularis GN=DRC3 PE=2 SV=1 200 326 2.0E-07
sp|B6D5P1|DAAF1_PERPL Dynein assembly factor 1, axonemal OS=Peromyscus polionotus GN=Dnaaf1 PE=2 SV=1 221 384 2.0E-07
sp|B4GT53|DAAF1_DROPE Dynein assembly factor 1, axonemal homolog OS=Drosophila persimilis GN=dtr PE=3 SV=1 154 272 2.0E-07
sp|B6D5P6|DAAF1_PERCA Dynein assembly factor 1, axonemal OS=Peromyscus californicus GN=Dnaaf1 PE=2 SV=1 221 384 2.0E-07
sp|Q9BXB1|LGR4_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Homo sapiens GN=LGR4 PE=1 SV=2 149 306 2.0E-07
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 108 336 2.0E-07
sp|P0CE12|SSPH2_SALTY E3 ubiquitin-protein ligase sspH2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sspH2 PE=1 SV=1 100 347 2.0E-07
sp|D0ZPH9|SSPH2_SALT1 E3 ubiquitin-protein ligase sspH2 OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=sspH2 PE=1 SV=1 100 347 2.0E-07
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 131 334 2.0E-07
sp|P35859|ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus GN=Igfals PE=1 SV=1 142 362 2.0E-07
sp|Q69ZB0|LRCC1_MOUSE Leucine-rich repeat and coiled-coil domain-containing protein 1 OS=Mus musculus GN=Lrrcc1 PE=2 SV=2 170 269 2.0E-07
sp|Q9CZ62|CEP97_MOUSE Centrosomal protein of 97 kDa OS=Mus musculus GN=Cep97 PE=1 SV=1 136 328 3.0E-07
sp|Q7Z4L9|PPR42_HUMAN Protein phosphatase 1 regulatory subunit 42 OS=Homo sapiens GN=PPP1R42 PE=2 SV=2 125 225 3.0E-07
sp|Q7ZV84|DAAF1_DANRE Dynein assembly factor 1, axonemal OS=Danio rerio GN=dnaaf1 PE=2 SV=2 250 342 3.0E-07
sp|Q9NJE9|TILB_TRYBB Protein tilB homolog OS=Trypanosoma brucei brucei GN=lrrc6 PE=3 SV=1 256 387 3.0E-07
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 107 311 3.0E-07
sp|Q5I2M3|TLR9_PIG Toll-like receptor 9 OS=Sus scrofa GN=TLR9 PE=2 SV=1 72 377 3.0E-07
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 107 280 4.0E-07
sp|Q6AYH9|DAAF1_RAT Dynein assembly factor 1, axonemal OS=Rattus norvegicus GN=Dnaaf1 PE=1 SV=1 221 384 4.0E-07
sp|P82963|CHAO_TRICA Chaoptin (Fragment) OS=Tribolium castaneum GN=CHP PE=2 SV=1 164 338 4.0E-07
sp|P90920|EGG6_CAEEL Leucine-rich repeat-containing protein egg-6 OS=Caenorhabditis elegans GN=egg-6 PE=2 SV=2 112 316 4.0E-07
sp|Q7XDQ7|PIRL8_ORYSJ Plant intracellular Ras-group-related LRR protein 8 OS=Oryza sativa subsp. japonica GN=IRL8 PE=2 SV=1 174 316 4.0E-07
sp|Q9H069|DRC3_HUMAN Dynein regulatory complex subunit 3 OS=Homo sapiens GN=DRC3 PE=2 SV=2 200 322 5.0E-07
sp|Q3UVD5|LGR6_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Mus musculus GN=Lgr6 PE=2 SV=1 147 351 5.0E-07
sp|Q9D2H9|DAAF1_MOUSE Dynein assembly factor 1, axonemal OS=Mus musculus GN=Dnaaf1 PE=1 SV=1 221 384 5.0E-07
sp|Q69ZB0|LRCC1_MOUSE Leucine-rich repeat and coiled-coil domain-containing protein 1 OS=Mus musculus GN=Lrrcc1 PE=2 SV=2 129 231 5.0E-07
sp|Q9Y2I1|NISCH_HUMAN Nischarin OS=Homo sapiens GN=NISCH PE=1 SV=3 93 240 5.0E-07
sp|Q8R1Z4|PPR42_MOUSE Protein phosphatase 1 regulatory subunit 42 OS=Mus musculus GN=Ppp1r42 PE=1 SV=1 168 385 5.0E-07
sp|Q6AXZ2|LRC46_RAT Leucine-rich repeat-containing protein 46 OS=Rattus norvegicus GN=Lrrc46 PE=1 SV=1 212 318 5.0E-07
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 174 336 5.0E-07
sp|F1MLX5|LGR4_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Bos taurus GN=LGR4 PE=3 SV=3 111 338 5.0E-07
sp|Q9WTR8|PHLP1_RAT PH domain leucine-rich repeat protein phosphatase 1 OS=Rattus norvegicus GN=Phlpp1 PE=1 SV=1 168 386 6.0E-07
sp|Q80TM9|NISCH_MOUSE Nischarin OS=Mus musculus GN=Nisch PE=1 SV=2 123 283 6.0E-07
sp|Q6XHA7|ROCO9_DICDI Probable serine/threonine-protein kinase roco9 OS=Dictyostelium discoideum GN=roco9 PE=3 SV=1 126 339 6.0E-07
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 174 336 6.0E-07
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 174 336 6.0E-07
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 125 336 7.0E-07
sp|Q8K377|LRRT1_MOUSE Leucine-rich repeat transmembrane neuronal protein 1 OS=Mus musculus GN=Lrrtm1 PE=2 SV=1 201 335 7.0E-07
sp|Q5DU41|LRC8B_MOUSE Volume-regulated anion channel subunit LRRC8B OS=Mus musculus GN=Lrrc8b PE=1 SV=3 149 304 7.0E-07
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 89 360 8.0E-07
sp|P70389|ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus GN=Igfals PE=1 SV=1 149 338 8.0E-07
sp|D4A6D8|LRRT1_RAT Leucine-rich repeat transmembrane neuronal protein 1 OS=Rattus norvegicus GN=Lrrtm1 PE=3 SV=1 201 335 8.0E-07
sp|O75094|SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens GN=SLIT3 PE=2 SV=3 145 274 8.0E-07
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 107 280 9.0E-07
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 172 340 9.0E-07
sp|Q9GZU5|NYX_HUMAN Nyctalopin OS=Homo sapiens GN=NYX PE=1 SV=1 148 363 9.0E-07
sp|Q9GKN8|PRELP_BOVIN Prolargin OS=Bos taurus GN=PRELP PE=2 SV=1 125 362 9.0E-07
sp|Q5XI54|DRC3_RAT Dynein regulatory complex subunit 3 OS=Rattus norvegicus GN=Drc3 PE=2 SV=1 149 221 1.0E-06
sp|A1A4H9|LRRT1_BOVIN Leucine-rich repeat transmembrane neuronal protein 1 OS=Bos taurus GN=LRRTM1 PE=2 SV=1 201 338 1.0E-06
sp|Q5I2M4|TLR9_SHEEP Toll-like receptor 9 OS=Ovis aries GN=TLR9 PE=2 SV=1 121 385 1.0E-06
sp|P28654|PGS2_MOUSE Decorin OS=Mus musculus GN=Dcn PE=1 SV=1 169 365 1.0E-06
sp|Q8BXA7|PHLP2_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Mus musculus GN=Phlpp2 PE=1 SV=3 119 352 1.0E-06
sp|Q32KP2|LRC23_BOVIN Leucine-rich repeat-containing protein 23 OS=Bos taurus GN=LRRC23 PE=2 SV=1 149 284 1.0E-06
sp|Q9DAP0|LRC46_MOUSE Leucine-rich repeat-containing protein 46 OS=Mus musculus GN=Lrrc46 PE=1 SV=2 212 318 1.0E-06
sp|Q86UE6|LRRT1_HUMAN Leucine-rich repeat transmembrane neuronal protein 1 OS=Homo sapiens GN=LRRTM1 PE=2 SV=2 201 338 1.0E-06
sp|Q01129|PGS2_RAT Decorin OS=Rattus norvegicus GN=Dcn PE=1 SV=1 166 359 1.0E-06
sp|Q5R6B1|LRRT1_PONAB Leucine-rich repeat transmembrane neuronal protein 1 OS=Pongo abelii GN=LRRTM1 PE=2 SV=1 201 338 1.0E-06
sp|P24014|SLIT_DROME Protein slit OS=Drosophila melanogaster GN=sli PE=1 SV=2 172 298 1.0E-06
sp|O46542|PGS2_HORSE Decorin OS=Equus caballus GN=DCN PE=2 SV=1 169 365 1.0E-06
sp|Q28888|PGS2_RABIT Decorin OS=Oryctolagus cuniculus GN=DCN PE=2 SV=1 169 365 1.0E-06
sp|Q16RY9|DAAF1_AEDAE Dynein assembly factor 1, axonemal homolog OS=Aedes aegypti GN=AAEL010772 PE=3 SV=1 174 313 1.0E-06
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 110 340 1.0E-06
sp|Q723X5|INLI_LISMF Internalin-I OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlI PE=3 SV=1 104 228 2.0E-06
sp|A0JM56|LRRC9_XENTR Leucine-rich repeat-containing protein 9 OS=Xenopus tropicalis GN=lrrc9 PE=2 SV=2 247 385 2.0E-06
sp|O35125|LRC23_MOUSE Leucine-rich repeat-containing protein 23 OS=Mus musculus GN=Lrrc23 PE=1 SV=1 149 384 2.0E-06
sp|Q16RY9|DAAF1_AEDAE Dynein assembly factor 1, axonemal homolog OS=Aedes aegypti GN=AAEL010772 PE=3 SV=1 136 274 2.0E-06
sp|P51885|LUM_MOUSE Lumican OS=Mus musculus GN=Lum PE=1 SV=2 126 361 2.0E-06
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 112 325 2.0E-06
sp|Q6UXK2|ISLR2_HUMAN Immunoglobulin superfamily containing leucine-rich repeat protein 2 OS=Homo sapiens GN=ISLR2 PE=2 SV=1 166 297 2.0E-06
sp|Q80XG9|LRRT4_MOUSE Leucine-rich repeat transmembrane neuronal protein 4 OS=Mus musculus GN=Lrrtm4 PE=1 SV=2 174 384 2.0E-06
sp|B4F7C5|LRRT4_RAT Leucine-rich repeat transmembrane neuronal protein 4 OS=Rattus norvegicus GN=Lrrtm4 PE=1 SV=1 174 384 2.0E-06
sp|Q99PH1|LRRC4_MOUSE Leucine-rich repeat-containing protein 4 OS=Mus musculus GN=Lrrc4 PE=1 SV=2 120 294 2.0E-06
sp|Q9HBW1|LRRC4_HUMAN Leucine-rich repeat-containing protein 4 OS=Homo sapiens GN=LRRC4 PE=1 SV=2 120 294 2.0E-06
sp|Q45R42|LRRC4_RAT Leucine-rich repeat-containing protein 4 OS=Rattus norvegicus GN=Lrrc4 PE=1 SV=1 120 294 2.0E-06
sp|Q7Z7A1|CNTRL_HUMAN Centriolin OS=Homo sapiens GN=CNTRL PE=1 SV=2 154 300 2.0E-06
sp|Q8BGI7|LRC39_MOUSE Leucine-rich repeat-containing protein 39 OS=Mus musculus GN=Lrrc39 PE=1 SV=1 152 291 2.0E-06
sp|P51886|LUM_RAT Lumican OS=Rattus norvegicus GN=Lum PE=1 SV=1 126 361 2.0E-06
sp|Q8CDN9|LRRC9_MOUSE Leucine-rich repeat-containing protein 9 OS=Mus musculus GN=Lrrc9 PE=1 SV=2 149 385 3.0E-06
sp|Q32KP2|LRC23_BOVIN Leucine-rich repeat-containing protein 23 OS=Bos taurus GN=LRRC23 PE=2 SV=1 149 360 3.0E-06
sp|P14605|CYAA_SCHPO Adenylate cyclase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyr1 PE=1 SV=1 148 352 3.0E-06
sp|Q96DD0|LRC39_HUMAN Leucine-rich repeat-containing protein 39 OS=Homo sapiens GN=LRRC39 PE=2 SV=1 122 292 3.0E-06
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 187 336 3.0E-06
sp|Q3SYS4|DAAF1_BOVIN Dynein assembly factor 1, axonemal OS=Bos taurus GN=DNAAF1 PE=2 SV=2 221 370 4.0E-06
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 137 351 4.0E-06
sp|Q7Z2Q7|LRR70_HUMAN Leucine-rich repeat-containing protein 70 OS=Homo sapiens GN=LRRC70 PE=2 SV=1 149 360 4.0E-06
sp|Q9CZT5|VASN_MOUSE Vasorin OS=Mus musculus GN=Vasn PE=2 SV=2 152 379 4.0E-06
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 125 335 4.0E-06
sp|P51884|LUM_HUMAN Lumican OS=Homo sapiens GN=LUM PE=1 SV=2 169 337 4.0E-06
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 126 362 4.0E-06
sp|F7D3V9|LGR5_XENTR Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Xenopus tropicalis GN=lgr5 PE=2 SV=2 148 338 4.0E-06
sp|O75325|LRRN2_HUMAN Leucine-rich repeat neuronal protein 2 OS=Homo sapiens GN=LRRN2 PE=2 SV=2 165 360 4.0E-06
sp|Q96JM4|LRIQ1_HUMAN Leucine-rich repeat and IQ domain-containing protein 1 OS=Homo sapiens GN=LRRIQ1 PE=2 SV=3 107 381 4.0E-06
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 141 316 5.0E-06
sp|Q5R1V9|PGS2_PANTR Decorin OS=Pan troglodytes GN=DCN PE=2 SV=1 169 365 5.0E-06
sp|P07585|PGS2_HUMAN Decorin OS=Homo sapiens GN=DCN PE=1 SV=1 169 365 5.0E-06
sp|Q86VH4|LRRT4_HUMAN Leucine-rich repeat transmembrane neuronal protein 4 OS=Homo sapiens GN=LRRTM4 PE=2 SV=2 174 340 5.0E-06
sp|Q5Y2C3|H2AY_TETTS Histone H2A.Y OS=Tetrahymena thermophila (strain SB210) GN=HTAY PE=2 SV=2 99 240 5.0E-06
sp|B9F655|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7 OS=Oryza sativa subsp. japonica GN=IRL7 PE=2 SV=1 202 362 5.0E-06
sp|Q8CDN9|LRRC9_MOUSE Leucine-rich repeat-containing protein 9 OS=Mus musculus GN=Lrrc9 PE=1 SV=2 215 385 6.0E-06
sp|Q7Z7A1|CNTRL_HUMAN Centriolin OS=Homo sapiens GN=CNTRL PE=1 SV=2 149 240 6.0E-06
sp|Q9WVB4|SLIT3_MOUSE Slit homolog 3 protein OS=Mus musculus GN=Slit3 PE=2 SV=2 151 274 6.0E-06
sp|Q1RMR5|TILB_BOVIN Protein tilB homolog OS=Bos taurus GN=LRRC6 PE=2 SV=1 143 252 7.0E-06
sp|Q5I2M7|TLR9_FELCA Toll-like receptor 9 OS=Felis catus GN=TLR9 PE=2 SV=1 121 335 7.0E-06
sp|Q3ZC49|LRC39_BOVIN Leucine-rich repeat-containing protein 39 OS=Bos taurus GN=LRRC39 PE=2 SV=1 122 292 7.0E-06
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 141 316 8.0E-06
sp|Q05443|LUM_BOVIN Lumican OS=Bos taurus GN=LUM PE=1 SV=1 126 346 8.0E-06
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 174 388 8.0E-06
sp|Q6ZRR7|LRRC9_HUMAN Leucine-rich repeat-containing protein 9 OS=Homo sapiens GN=LRRC9 PE=2 SV=2 162 313 9.0E-06
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 147 316 9.0E-06
sp|Q16RY9|DAAF1_AEDAE Dynein assembly factor 1, axonemal homolog OS=Aedes aegypti GN=AAEL010772 PE=3 SV=1 162 286 9.0E-06
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 122 357 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6174
MPAPENNAADTPARIDIHHDRLEDTEAGSPMRNSRGWDGKLRVSKSANQEALSDLECSGDSAVASDHDVQEISAD
EGGRRRVDDPDPRLTKTDLLDSEDSETDEIMCSQSRVADISSLGLERFHKVTRICLRQNRIQEIGGLECLATTLK
DLDLYDNLISHIRGLEHLPNLTSLDLSFNKIKHIKHVSHMAQLKELFLVANKISKIEGLQGLESLTSLELGSNRI
RELENLDKLKNLEELWVAKNKITELKGLAGLPNLRLLSIQSNRIRDLSPLKDVANLEELYISHNALESLEGLEGN
TKLKILDISNNQVSSLGGLASLTELEELWASYNKLADLADVESVLKDKQHLTTVYFEGNPLQLRGPTLYRNKVRL
ALPQVRQIDASKS*
Coding >Ophun1|6174
ATGCCCGCTCCCGAGAACAATGCCGCCGACACGCCTGCCCGCATCGACATTCACCATGACCGTCTCGAGGACACC
GAGGCCGGCTCGCCCATGAGAAACAGCAGAGGATGGGACGGCAAGCTGCGGGTATCCAAGTCGGCCAACCAAGAG
GCCCTCTCCGACCTCGAGTGCTCGGGCGACAGCGCCGTCGCGTCGGACCACGATGTGCAGGAGATCAGCGCCGAC
GAAGGTGGGCGACGTCGCGTCGACGACCCGGACCCTCGGCTGACCAAGACAGATCTCCTCGATAGCGAAGACTCG
GAGACGGATGAGATTATGTGTTCCCAGTCGCGCGTTGCTGACATATCGTCGCTGGGACTCGAGCGCTTCCATAAG
GTGACGCGCATCTGCCTGCGCCAAAATCGCATCCAGGAAATCGGTGGCCTGGAATGTCTCGCGACGACGTTAAAG
GACCTCGACCTCTACGACAATCTCATCTCCCACATTCGCGGTCTGGAACATCTACCGAATCTCACCAGCCTGGAC
TTGAGCTTCAACAAGATCAAACACATCAAGCATGTCAGCCACATGGCACAGCTGAAGGAGCTGTTCCTCGTCGCC
AACAAGATCAGCAAGATAGAAGGTCTGCAAGGGCTAGAAAGCCTCACCTCACTCGAATTGGGCTCCAATCGCATT
CGCGAGCTGGAGAATCTAGACAAGCTTAAGAATCTCGAGGAGCTATGGGTGGCCAAGAATAAGATCACGGAACTG
AAAGGCTTGGCCGGACTCCCCAATCTACGGCTGCTCAGCATCCAGTCGAACCGCATCAGGGACCTGTCTCCACTC
AAGGATGTCGCCAATCTGGAAGAGCTGTACATCTCGCACAATGCGCTAGAATCGCTCGAGGGCCTCGAAGGAAAC
ACGAAGCTCAAGATCCTCGACATTTCCAACAACCAAGTCAGCAGCCTCGGCGGACTGGCCAGCCTGACTGAGCTG
GAGGAGCTGTGGGCCAGCTACAACAAACTGGCAGACCTCGCCGACGTGGAAAGCGTGCTGAAAGACAAGCAGCAC
CTCACAACGGTCTACTTCGAGGGCAACCCGCTGCAGCTCCGGGGCCCGACCCTGTACCGGAACAAGGTCCGTCTG
GCCCTGCCGCAGGTCAGGCAAATCGACGCAAGTAAGTCTTGA
Transcript >Ophun1|6174
ATGCCCGCTCCCGAGAACAATGCCGCCGACACGCCTGCCCGCATCGACATTCACCATGACCGTCTCGAGGACACC
GAGGCCGGCTCGCCCATGAGAAACAGCAGAGGATGGGACGGCAAGCTGCGGGTATCCAAGTCGGCCAACCAAGAG
GCCCTCTCCGACCTCGAGTGCTCGGGCGACAGCGCCGTCGCGTCGGACCACGATGTGCAGGAGATCAGCGCCGAC
GAAGGTGGGCGACGTCGCGTCGACGACCCGGACCCTCGGCTGACCAAGACAGATCTCCTCGATAGCGAAGACTCG
GAGACGGATGAGATTATGTGTTCCCAGTCGCGCGTTGCTGACATATCGTCGCTGGGACTCGAGCGCTTCCATAAG
GTGACGCGCATCTGCCTGCGCCAAAATCGCATCCAGGAAATCGGTGGCCTGGAATGTCTCGCGACGACGTTAAAG
GACCTCGACCTCTACGACAATCTCATCTCCCACATTCGCGGTCTGGAACATCTACCGAATCTCACCAGCCTGGAC
TTGAGCTTCAACAAGATCAAACACATCAAGCATGTCAGCCACATGGCACAGCTGAAGGAGCTGTTCCTCGTCGCC
AACAAGATCAGCAAGATAGAAGGTCTGCAAGGGCTAGAAAGCCTCACCTCACTCGAATTGGGCTCCAATCGCATT
CGCGAGCTGGAGAATCTAGACAAGCTTAAGAATCTCGAGGAGCTATGGGTGGCCAAGAATAAGATCACGGAACTG
AAAGGCTTGGCCGGACTCCCCAATCTACGGCTGCTCAGCATCCAGTCGAACCGCATCAGGGACCTGTCTCCACTC
AAGGATGTCGCCAATCTGGAAGAGCTGTACATCTCGCACAATGCGCTAGAATCGCTCGAGGGCCTCGAAGGAAAC
ACGAAGCTCAAGATCCTCGACATTTCCAACAACCAAGTCAGCAGCCTCGGCGGACTGGCCAGCCTGACTGAGCTG
GAGGAGCTGTGGGCCAGCTACAACAAACTGGCAGACCTCGCCGACGTGGAAAGCGTGCTGAAAGACAAGCAGCAC
CTCACAACGGTCTACTTCGAGGGCAACCCGCTGCAGCTCCGGGGCCCGACCCTGTACCGGAACAAGGTCCGTCTG
GCCCTGCCGCAGGTCAGGCAAATCGACGCAAGTAAGTCTTGA
Gene >Ophun1|6174
ATGCCCGCTCCCGAGAACAATGCCGCCGACACGCCTGCCCGCATCGACATTCACCATGACCGTCTCGAGGACACC
GAGGCCGGCTCGCCCATGAGAAACAGCAGAGGATGGGACGGCAAGCTGCGGGTATCCAAGTCGGCCAACCAAGAG
GCCCTCTCCGACCTCGAGTGCTCGGGCGACAGCGCCGTCGCGTCGGACCACGATGTGCAGGAGATCAGCGCCGAC
GAAGGTGGGCGACGTCGCGTCGACGACCCGGACCCTCGGCTGACCAAGACAGATCTCCTCGATAGCGAAGACTCG
GAGACGGATGAGATTATGTGTTCCCAGTCGCGCGTTGCTGACATATCGTCGCTGGGACTCGAGCGCTTCCATAAG
GTGACGCGCATCTGCCTGCGCCAAAATCGCATCCAGGAAATCGGTGGCCTGGAATGTCTCGCGACGACGTTAAAG
GACCTCGACCTCTACGACAATCTCATCTCCCACATTCGCGGTCTGGAACATCTACCGAATCTCACCAGCCTGGAC
TTGAGCTTCAACAAGATCAAACACATCAAGCATGTCAGCCACATGGCACAGCTGAAGGAGCTGTTCCTCGTCGCC
AACAAGATCAGCAAGATAGAAGGTCTGCAAGGGCTAGAAAGCCTCACCTCACTCGAATTGGGCTCCAATCGCATT
CGCGAGCTGGAGAATCTAGACAAGCTTAAGAATCTCGAGGAGCTATGGGTGGCCAAGAATAAGATCACGGAACTG
AAAGGCTTGGCCGGACTCCCCAATCTACGGCTGCTCAGCATCCAGTCGAACCGCATCAGGGACCTGTCTCCACTC
AAGGATGTCGCCAATCTGGAAGAGCTGTACATCTCGCACAATGCGCTAGAATCGCTCGAGGGCCTCGAAGGAAAC
ACGAAGCTCAAGATCCTCGACATTTCCAACAACCAAGTCAGCAGCCTCGGCGGACTGGCCAGCCTGACTGAGCTG
GAGGAGCTGTGGGCCAGCTACAACAAACTGGCAGACCTCGCCGACGTGGAAAGCGTGCTGAAAGACAAGCAGCAC
CTCACAACGGTCTACTTCGAGGGCAACCCGCTGCAGCTCCGGGGCCCGACCCTGTACCGGAACAAGGTCCGTCTG
GCCCTGCCGCAGGTCAGGCAAATCGACGCAAGTAAGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail