Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6165
Gene name
LocationContig_654:7708..9838
Strand-
Gene length (bp)2130
Transcript length (bp)1962
Coding sequence length (bp)1962
Protein length (aa) 654

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08647 BRE1 BRE1 E3 ubiquitin ligase 1.8E-27 406 499
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 4.0E-08 600 645
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 8.3E-08 601 639
PF14447 Prok-RING_4 Prokaryotic RING finger family 4 1.6E-07 601 646
PF13445 zf-RING_UBOX RING-type zinc-finger 5.9E-07 601 637
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 2.0E-06 601 639

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S304|BRE1_NEUCR E3 ubiquitin-protein ligase bre1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=upl-1 PE=3 SV=2 1 652 0.0E+00
sp|Q4I7N9|BRE1_GIBZE E3 ubiquitin-protein ligase BRE1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BRE1 PE=3 SV=1 1 653 0.0E+00
sp|Q2U9B0|BRE1_ASPOR E3 ubiquitin-protein ligase bre1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bre1 PE=3 SV=1 1 651 1.0E-150
sp|Q4WDD7|BRE1_ASPFU E3 ubiquitin-protein ligase bre1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bre1 PE=3 SV=2 1 651 8.0E-150
sp|Q6CF78|BRE1_YARLI E3 ubiquitin-protein ligase BRE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BRE1 PE=3 SV=1 148 652 7.0E-51
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S304|BRE1_NEUCR E3 ubiquitin-protein ligase bre1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=upl-1 PE=3 SV=2 1 652 0.0E+00
sp|Q4I7N9|BRE1_GIBZE E3 ubiquitin-protein ligase BRE1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BRE1 PE=3 SV=1 1 653 0.0E+00
sp|Q2U9B0|BRE1_ASPOR E3 ubiquitin-protein ligase bre1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bre1 PE=3 SV=1 1 651 1.0E-150
sp|Q4WDD7|BRE1_ASPFU E3 ubiquitin-protein ligase bre1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bre1 PE=3 SV=2 1 651 8.0E-150
sp|Q6CF78|BRE1_YARLI E3 ubiquitin-protein ligase BRE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BRE1 PE=3 SV=1 148 652 7.0E-51
sp|Q07457|BRE1_YEAST E3 ubiquitin-protein ligase BRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRE1 PE=1 SV=1 134 652 3.0E-46
sp|Q6BWW6|BRE1_DEBHA E3 ubiquitin-protein ligase BRE1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BRE1 PE=3 SV=2 128 652 2.0E-43
sp|Q757D9|BRE1_ASHGO E3 ubiquitin-protein ligase BRE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BRE1 PE=3 SV=1 130 652 3.0E-40
sp|Q5A4X0|BRE1_CANAL E3 ubiquitin-protein ligase BRE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BRE1 PE=3 SV=1 1 652 2.0E-38
sp|Q6FWF3|BRE1_CANGA E3 ubiquitin-protein ligase BRE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BRE1 PE=3 SV=1 166 652 2.0E-37
sp|Q6CWM4|BRE1_KLULA E3 ubiquitin-protein ligase BRE1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BRE1 PE=3 SV=1 141 652 8.0E-37
sp|O74563|BRL2_SCHPO E3 ubiquitin-protein ligase brl2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brl2 PE=1 SV=1 12 652 4.0E-24
sp|Q4P3X7|BRE1_USTMA E3 ubiquitin-protein ligase BRE1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BRE1 PE=3 SV=1 404 652 4.0E-21
sp|P0CQ62|BRE1_CRYNJ E3 ubiquitin-protein ligase BRE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BRE1 PE=3 SV=1 403 652 2.0E-18
sp|P0CQ63|BRE1_CRYNB E3 ubiquitin-protein ligase BRE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BRE1 PE=3 SV=1 403 652 2.0E-18
sp|Q1MTQ0|BRL1_SCHPO E3 ubiquitin-protein ligase brl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brl1 PE=1 SV=1 140 652 3.0E-18
sp|Q6LFN2|ZNRF1_PLAF7 RING finger protein PFF0165c OS=Plasmodium falciparum (isolate 3D7) GN=PFF0165c PE=2 SV=1 556 651 5.0E-11
sp|Q86KL1|BRE1_DICDI Probable E3 ubiquitin-protein ligase bre1 OS=Dictyostelium discoideum GN=bre1 PE=3 SV=1 601 653 9.0E-10
sp|A2XW69|BRE1A_ORYSI E3 ubiquitin-protein ligase BRE1-like 1 OS=Oryza sativa subsp. indica GN=BRE1A PE=3 SV=2 596 652 1.0E-09
sp|Q7XU27|BRE1A_ORYSJ E3 ubiquitin-protein ligase BRE1-like 1 OS=Oryza sativa subsp. japonica GN=BRE1A PE=2 SV=3 596 652 2.0E-09
sp|Q8CJB9|BRE1B_RAT E3 ubiquitin-protein ligase BRE1B OS=Rattus norvegicus GN=Rnf40 PE=1 SV=1 389 652 4.0E-09
sp|Q3U319|BRE1B_MOUSE E3 ubiquitin-protein ligase BRE1B OS=Mus musculus GN=Rnf40 PE=1 SV=2 389 652 4.0E-09
sp|O75150|BRE1B_HUMAN E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens GN=RNF40 PE=1 SV=4 389 652 5.0E-09
sp|Q5RAU7|BRE1B_PONAB E3 ubiquitin-protein ligase BRE1B OS=Pongo abelii GN=RNF40 PE=2 SV=1 389 652 5.0E-09
sp|Q4R7K7|BRE1B_MACFA E3 ubiquitin-protein ligase BRE1B OS=Macaca fascicularis GN=RNF40 PE=2 SV=1 389 652 5.0E-09
sp|Q8RXD6|BRE1A_ARATH E3 ubiquitin-protein ligase BRE1-like 1 OS=Arabidopsis thaliana GN=HUB1 PE=1 SV=1 589 652 1.0E-07
sp|Q4P3X7|BRE1_USTMA E3 ubiquitin-protein ligase BRE1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BRE1 PE=3 SV=1 168 368 1.0E-06
sp|Q336R3|BRE1B_ORYSJ E3 ubiquitin-protein ligase BRE1-like 2 OS=Oryza sativa subsp. japonica GN=BRE1B PE=2 SV=1 601 651 4.0E-06
sp|A2ZAC2|BRE1B_ORYSI E3 ubiquitin-protein ligase BRE1-like 2 OS=Oryza sativa subsp. indica GN=BRE1B PE=3 SV=2 601 651 4.0E-06
sp|Q9C895|BRE1B_ARATH E3 ubiquitin-protein ligase BRE1-like 2 OS=Arabidopsis thaliana GN=HUB2 PE=2 SV=2 601 651 4.0E-06
sp|Q5ZLS3|BRE1A_CHICK E3 ubiquitin-protein ligase BRE1A OS=Gallus gallus GN=RNF20 PE=2 SV=1 601 652 4.0E-06
sp|A2VDP1|BRE1A_BOVIN E3 ubiquitin-protein ligase BRE1A OS=Bos taurus GN=RNF20 PE=2 SV=1 601 652 4.0E-06
sp|Q5VTR2|BRE1A_HUMAN E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens GN=RNF20 PE=1 SV=2 601 652 5.0E-06
sp|Q5DTM8|BRE1A_MOUSE E3 ubiquitin-protein ligase BRE1A OS=Mus musculus GN=Rnf20 PE=1 SV=2 601 652 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6165
MLEYSRKAATTESRLEELHKRCVHHDDHLRIIDGWWRQLLEEVEVLAKGTLPDTVSPTEPPYLSGVSFKDLHEFQ
SHMQEKGKAIKAKAESLLCHIAAHRGKIEPDVAAMEGKITSLLSAQKEYLLKLDRLDSEKEQLSEQLNAATLRYF
RAEKKLDRAKSAQVQKLEQQAFANATKPAATPGDGGQDSAESNGNADDLQVKYEEAMTSATKQKEQLDAALSEFR
ALQDENSNLKCRQNAWSDEDLVRSDVFKQFKGQNEDLIKRVNNLEATNKQLREEAEKLQAERTAFKGQLETDANQ
VTQELESEVMSRDQDLARVRSARDEILAENTQRKASMDQDRTSLTLLRDLIEAKDDRIAALESKLARLEPTGDDE
ASPPADDAQELSAEDLRQRYKKLQQDFHAINQELPSIEKAYKKMKDLAQKKVVEVVALEDKVALLIAEKSKADQK
YFAARKDADTRNNEIRSLRHQNSKSTEIIAQLKDVETQTRTLLGNLEKQLADLKQTNAVLTADNKKVETTSHDAV
RRAETLNRQIADMSAVVKSRDAAAAAARERCLAQEAETEKLKVRLEHAQKDRDTWRSKALSNSSEEEEMLRTFAL
CTICRNNFKNTALRTCGHLFCTKCVDDRISNRMRKCPTCSRAFDKMDVMPVHH*
Coding >Ophun1|6165
ATGCTCGAGTATAGCCGCAAGGCAGCTACCACCGAATCGCGACTCGAAGAGCTGCATAAGCGATGCGTTCATCAC
GACGATCATTTGAGGATTATCGATGGCTGGTGGCGCCAGCTGTTGGAGGAAGTAGAAGTCCTCGCAAAGGGCACC
TTGCCTGACACCGTCAGTCCGACGGAGCCCCCATATCTCAGCGGCGTCAGCTTCAAGGACCTCCACGAATTCCAG
AGCCACATGCAGGAAAAGGGCAAGGCGATCAAGGCCAAGGCCGAGTCTCTTCTATGTCACATCGCTGCCCATCGT
GGAAAGATTGAACCCGACGTCGCTGCCATGGAGGGTAAAATCACCAGCTTGCTGTCCGCGCAGAAGGAATACCTC
CTCAAGCTCGACCGCCTGGACTCCGAAAAGGAACAACTCTCGGAGCAGCTCAACGCTGCCACCCTCCGATATTTC
AGGGCCGAAAAGAAGCTTGATCGGGCAAAGAGCGCGCAGGTCCAGAAGCTTGAGCAGCAAGCATTCGCGAATGCC
ACCAAGCCCGCCGCCACCCCCGGAGACGGCGGTCAGGATTCCGCCGAGTCCAATGGCAACGCCGACGACCTGCAG
GTCAAGTACGAGGAGGCCATGACGTCGGCAACGAAGCAGAAGGAGCAGCTGGACGCGGCTCTGTCGGAGTTTAGG
GCCCTGCAAGACGAAAACTCGAACCTCAAGTGTCGTCAGAATGCATGGAGCGACGAAGACTTGGTCCGCTCTGAT
GTCTTCAAGCAATTCAAAGGTCAAAACGAAGACCTCATCAAGCGGGTCAACAACTTGGAGGCAACCAACAAACAA
CTACGCGAGGAGGCGGAGAAGCTCCAGGCCGAGCGCACCGCTTTCAAGGGCCAACTCGAGACGGATGCGAACCAA
GTGACTCAAGAACTCGAGAGTGAAGTCATGAGCAGGGACCAGGACCTGGCTCGCGTACGATCTGCCAGGGACGAG
ATACTGGCGGAGAACACGCAGCGCAAGGCCAGCATGGACCAGGACAGGACTTCATTGACTCTGCTCAGAGATCTC
ATCGAAGCAAAGGACGACCGCATCGCTGCGCTGGAATCTAAACTGGCGCGACTCGAGCCGACGGGAGACGATGAA
GCGTCACCACCGGCAGACGACGCCCAGGAGCTTTCGGCAGAGGATCTCCGACAAAGGTACAAAAAGCTCCAGCAA
GACTTTCACGCCATCAATCAGGAGTTGCCGTCGATCGAGAAGGCGTACAAGAAGATGAAGGATCTGGCGCAGAAG
AAGGTCGTTGAAGTGGTGGCGCTCGAGGACAAGGTTGCCCTCTTGATTGCCGAGAAGAGCAAGGCAGACCAGAAG
TACTTTGCTGCGCGGAAAGATGCCGACACTCGAAACAACGAGATCCGATCGCTCAGGCATCAGAACAGCAAAAGC
ACGGAGATTATCGCTCAGCTCAAGGATGTCGAAACGCAGACTAGGACCCTGCTGGGCAACCTCGAGAAGCAGCTC
GCGGATCTCAAGCAGACCAACGCCGTGCTGACGGCAGATAATAAGAAGGTGGAGACGACCAGCCACGATGCCGTG
AGGCGAGCCGAAACTCTGAACCGTCAGATTGCGGACATGTCAGCCGTGGTCAAGTCCCGGGACGCGGCGGCGGCG
GCAGCCCGAGAGCGCTGCTTGGCTCAGGAGGCCGAGACGGAGAAGCTCAAGGTGCGGCTCGAGCACGCGCAGAAA
GACCGGGACACTTGGCGCAGCAAGGCGTTGAGCAATTCGTCTGAAGAGGAAGAGATGCTACGGACGTTTGCTCTG
TGTACGATTTGCCGCAACAACTTTAAGAATACGGCGTTGAGGACCTGCGGCCACCTCTTTTGCACCAAATGCGTC
GACGATCGCATCAGCAATCGCATGCGCAAGTGCCCTACTTGCTCCCGCGCATTCGACAAGATGGACGTCATGCCA
GTTCATCACTAA
Transcript >Ophun1|6165
ATGCTCGAGTATAGCCGCAAGGCAGCTACCACCGAATCGCGACTCGAAGAGCTGCATAAGCGATGCGTTCATCAC
GACGATCATTTGAGGATTATCGATGGCTGGTGGCGCCAGCTGTTGGAGGAAGTAGAAGTCCTCGCAAAGGGCACC
TTGCCTGACACCGTCAGTCCGACGGAGCCCCCATATCTCAGCGGCGTCAGCTTCAAGGACCTCCACGAATTCCAG
AGCCACATGCAGGAAAAGGGCAAGGCGATCAAGGCCAAGGCCGAGTCTCTTCTATGTCACATCGCTGCCCATCGT
GGAAAGATTGAACCCGACGTCGCTGCCATGGAGGGTAAAATCACCAGCTTGCTGTCCGCGCAGAAGGAATACCTC
CTCAAGCTCGACCGCCTGGACTCCGAAAAGGAACAACTCTCGGAGCAGCTCAACGCTGCCACCCTCCGATATTTC
AGGGCCGAAAAGAAGCTTGATCGGGCAAAGAGCGCGCAGGTCCAGAAGCTTGAGCAGCAAGCATTCGCGAATGCC
ACCAAGCCCGCCGCCACCCCCGGAGACGGCGGTCAGGATTCCGCCGAGTCCAATGGCAACGCCGACGACCTGCAG
GTCAAGTACGAGGAGGCCATGACGTCGGCAACGAAGCAGAAGGAGCAGCTGGACGCGGCTCTGTCGGAGTTTAGG
GCCCTGCAAGACGAAAACTCGAACCTCAAGTGTCGTCAGAATGCATGGAGCGACGAAGACTTGGTCCGCTCTGAT
GTCTTCAAGCAATTCAAAGGTCAAAACGAAGACCTCATCAAGCGGGTCAACAACTTGGAGGCAACCAACAAACAA
CTACGCGAGGAGGCGGAGAAGCTCCAGGCCGAGCGCACCGCTTTCAAGGGCCAACTCGAGACGGATGCGAACCAA
GTGACTCAAGAACTCGAGAGTGAAGTCATGAGCAGGGACCAGGACCTGGCTCGCGTACGATCTGCCAGGGACGAG
ATACTGGCGGAGAACACGCAGCGCAAGGCCAGCATGGACCAGGACAGGACTTCATTGACTCTGCTCAGAGATCTC
ATCGAAGCAAAGGACGACCGCATCGCTGCGCTGGAATCTAAACTGGCGCGACTCGAGCCGACGGGAGACGATGAA
GCGTCACCACCGGCAGACGACGCCCAGGAGCTTTCGGCAGAGGATCTCCGACAAAGGTACAAAAAGCTCCAGCAA
GACTTTCACGCCATCAATCAGGAGTTGCCGTCGATCGAGAAGGCGTACAAGAAGATGAAGGATCTGGCGCAGAAG
AAGGTCGTTGAAGTGGTGGCGCTCGAGGACAAGGTTGCCCTCTTGATTGCCGAGAAGAGCAAGGCAGACCAGAAG
TACTTTGCTGCGCGGAAAGATGCCGACACTCGAAACAACGAGATCCGATCGCTCAGGCATCAGAACAGCAAAAGC
ACGGAGATTATCGCTCAGCTCAAGGATGTCGAAACGCAGACTAGGACCCTGCTGGGCAACCTCGAGAAGCAGCTC
GCGGATCTCAAGCAGACCAACGCCGTGCTGACGGCAGATAATAAGAAGGTGGAGACGACCAGCCACGATGCCGTG
AGGCGAGCCGAAACTCTGAACCGTCAGATTGCGGACATGTCAGCCGTGGTCAAGTCCCGGGACGCGGCGGCGGCG
GCAGCCCGAGAGCGCTGCTTGGCTCAGGAGGCCGAGACGGAGAAGCTCAAGGTGCGGCTCGAGCACGCGCAGAAA
GACCGGGACACTTGGCGCAGCAAGGCGTTGAGCAATTCGTCTGAAGAGGAAGAGATGCTACGGACGTTTGCTCTG
TGTACGATTTGCCGCAACAACTTTAAGAATACGGCGTTGAGGACCTGCGGCCACCTCTTTTGCACCAAATGCGTC
GACGATCGCATCAGCAATCGCATGCGCAAGTGCCCTACTTGCTCCCGCGCATTCGACAAGATGGACGTCATGCCA
GTTCATCACTAA
Gene >Ophun1|6165
ATGCTCGAGTATAGCCGCAAGGCAGCTACCACCGAATCGCGACTCGAAGAGCTGCATAAGCGATGCGTTCATCAC
GACGATCATTTGAGGATTATCGATGGCTGGTGGCGCCAGGTCCGCTTTCGTCCGTCCCCTTTCCAACGCCTGGCT
GACTTGGCTGCAACAGCTGTTGGAGGAAGTAGAAGTCCTCGCAAAGGGCACCTTGCCTGACACCGTCAGTCCGAC
GGGTATGTTGATACAGGCTTCTCTGCACGTCAAAGTTTCTCCTAACGAAAACCGACCAGAGCCCCCATATCTCAG
CGGCGTCAGCTTCAAGGACCTCCACGAATTCCAGAGCCACATGCAGGAAAAGGGCAAGGCGATCAAGGCCAAGGC
CGAGTCTCTTCTATGTCACATCGCTGCCCATCGTGGAAAGATTGAACCCGACGTCGCTGCCATGGAGGGTAAAAT
CACCAGCTTGCTGTCCGCGCAGAAGGAATACCTCCTCAAGCTCGACCGCCTGGACTCCGAAAAGGAACAACTCTC
GGAGCAGCTCAACGCTGCCACCCTCCGATATTTCAGGGCCGAAAAGAAGCTTGATCGGGCAAAGAGCGCGCAGGT
CCAGAAGCTTGAGCAGCAAGCATTCGCGAATGCCACCAAGCCCGCCGCCACCCCCGGAGACGGCGGTCAGGATTC
CGCCGAGTCCAATGGCAACGCCGACGACCTGCAGGTCAAGTACGAGGAGGCCATGACGTCGGCAACGAAGCAGAA
GGAGCAGCTGGACGCGGCTCTGTCGGAGTTTAGGGCCCTGCAAGACGAAAACTCGAACCTCAAGTGTCGTCAGAA
TGCATGGAGCGACGAAGACTTGGTCCGCTCTGATGTCTTCAAGCAATTCAAAGGTCAAAACGAAGACCTCATCAA
GCGGGTCAACAACTTGGAGGCAACCAACAAACAACTACGCGAGGAGGCGGAGAAGCTCCAGGCCGAGCGCACCGC
TTTCAAGGGCCAACTCGAGACGGATGCGAACCAAGTGACTCAAGAACTCGAGAGTGAAGTCATGAGCAGGGACCA
GGACCTGGCTCGCGTACGATCTGCCAGGGACGAGATACTGGCGGAGAACACGCAGCGCAAGGCCAGCATGGACCA
GGACAGGACTTCATTGACTCTGCTCAGAGATCTCATCGAAGCAAAGGACGACCGCATCGCTGCGCTGGAATCTAA
ACTGGCGCGACTCGAGCCGACGGGAGACGATGAAGCGTCACCACCGGCAGACGACGCCCAGGAGCTTTCGGCAGA
GGATCTCCGACAAAGGTACAAAAAGCTCCAGCAAGACTTTCACGCCATCAATCAGGAGTTGCCGTCGATCGAGAA
GGCGTACAAGAAGATGAAGGATCTGGCGCAGAAGAAGGTCGTTGAAGTGGTGGCGCTCGAGGACAAGGTTGCCCT
CTTGATTGCCGAGAAGAGCAAGGCAGACCAGAAGTACTTTGCTGCGCGGAAAGATGCCGACACTCGAAACAACGA
GATCCGATCGCTCAGGCATCAGAACAGCAAAAGCACGGAGATTATCGCTCAGCTCAAGGATGTCGAAACGCAGAC
TAGGACCCTGCTGGGCAACCTCGAGAAGCAGCTCGCGGATCTCAAGCAGACCAACGCCGTGCTGACGGCAGATAA
TAAGAAGGTGGAGACGACCAGCCACGATGCCGTGAGGCGAGCCGAAACTCTGAACCGTCAGATTGCGGACATGTC
AGCCGTGGTCAAGTCCCGGGACGCGGCGGCGGCGGCAGCCCGAGAGCGCTGCTTGGCTCAGGAGGCCGAGACGGA
GAAGCTCAAGGTGCGGCTCGAGCACGCGCAGAAAGACCGGGACACTTGGCGCAGCAAGGCGTTGAGCAATTCGTC
TGAAGAGGAAGAGATGCTACGGGTGAGTCGAAACACCCCTCCACCTGCTCGAGTCCTGTGGATCGCTGACGTCGA
CTTCAGACGTTTGCTCTGTGTACGATTTGCCGCAACAACTTTAAGAATACGGCGTTGAGGACCTGCGGCCACCTC
TTTTGCACCAAATGCGTCGACGATCGCATCAGCAATCGCATGCGCAAGTGCCCTACTTGCTCCCGCGCATTCGAC
AAGATGGACGTCATGCCAGTTCATCACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail