Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6159
Gene name
LocationContig_653:1115..3424
Strand+
Gene length (bp)2309
Transcript length (bp)2250
Coding sequence length (bp)2250
Protein length (aa) 750

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 1.5E-37 1 271
PF14492 EFG_III Elongation Factor G, domain III 4.8E-15 408 481
PF00679 EFG_C Elongation factor G C-terminus 8.7E-07 700 745

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B6Q1T9|RRF2M_TALMQ Ribosome-releasing factor 2, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=mef2 PE=3 SV=1 1 749 3.0E-157
sp|Q5BB57|RRF2M_EMENI Ribosome-releasing factor 2, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mef2 PE=3 SV=1 1 749 5.0E-155
sp|B8NDZ1|RRF2M_ASPFN Ribosome-releasing factor 2, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mef2 PE=3 SV=1 1 749 1.0E-154
sp|B8MR69|RRF2M_TALSN Ribosome-releasing factor 2, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=mef2 PE=3 SV=2 1 749 6.0E-154
sp|A2R994|RRF2M_ASPNC Ribosome-releasing factor 2, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mef2 PE=3 SV=1 1 749 6.0E-154
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B6Q1T9|RRF2M_TALMQ Ribosome-releasing factor 2, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=mef2 PE=3 SV=1 1 749 3.0E-157
sp|Q5BB57|RRF2M_EMENI Ribosome-releasing factor 2, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mef2 PE=3 SV=1 1 749 5.0E-155
sp|B8NDZ1|RRF2M_ASPFN Ribosome-releasing factor 2, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mef2 PE=3 SV=1 1 749 1.0E-154
sp|B8MR69|RRF2M_TALSN Ribosome-releasing factor 2, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=mef2 PE=3 SV=2 1 749 6.0E-154
sp|A2R994|RRF2M_ASPNC Ribosome-releasing factor 2, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mef2 PE=3 SV=1 1 749 6.0E-154
sp|Q5AAV3|RRF2M_CANAL Ribosome-releasing factor 2, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MEF2 PE=3 SV=1 1 745 2.0E-111
sp|B9W892|RRF2M_CANDC Ribosome-releasing factor 2, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=MEF2 PE=3 SV=1 1 745 1.0E-108
sp|Q6CBI0|RRF2M_YARLI Ribosome-releasing factor 2, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MEF2 PE=3 SV=1 1 741 2.0E-108
sp|B5RUN4|RRF2M_DEBHA Ribosome-releasing factor 2, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MEF2 PE=3 SV=1 1 745 3.0E-108
sp|A5DTX8|RRF2M_LODEL Ribosome-releasing factor 2, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MEF2 PE=3 SV=1 1 745 4.0E-107
sp|A3LWR2|RRF2M_PICST Ribosome-releasing factor 2, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MEF2 PE=3 SV=2 1 745 6.0E-106
sp|A5DB27|RRF2M_PICGU Ribosome-releasing factor 2, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MEF2 PE=3 SV=2 1 742 3.0E-104
sp|A6ZQM4|RRF2M_YEAS7 Ribosome-releasing factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=MEF2 PE=3 SV=1 1 749 1.0E-102
sp|Q754I9|RRF2M_ASHGO Ribosome-releasing factor 2, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MEF2 PE=3 SV=1 1 749 2.0E-102
sp|P39677|RRF2M_YEAST Ribosome-releasing factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEF2 PE=1 SV=1 1 749 3.0E-102
sp|B3LQ11|RRF2M_YEAS1 Ribosome-releasing factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=MEF2 PE=3 SV=1 1 749 3.0E-102
sp|O94429|RRF2M_SCHPO Ribosome-releasing factor 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mef2 PE=3 SV=1 1 733 5.0E-100
sp|Q6FLG2|RRF2M_CANGA Ribosome-releasing factor 2, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MEF2 PE=3 SV=1 1 745 6.0E-98
sp|A7TQJ9|RRF2M_VANPO Ribosome-releasing factor 2, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MEF2 PE=3 SV=1 1 745 3.0E-94
sp|A0LRL7|EFG_ACIC1 Elongation factor G OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=fusA PE=3 SV=1 1 741 2.0E-93
sp|Q6CK29|RRF2M_KLULA Ribosome-releasing factor 2, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MEF2 PE=3 SV=1 1 745 3.0E-93
sp|Q7MA53|EFG_WOLSU Elongation factor G OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=fusA PE=3 SV=1 1 747 8.0E-92
sp|Q1MPS9|EFG_LAWIP Elongation factor G OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=fusA PE=3 SV=1 1 741 1.0E-91
sp|Q2JFH9|EFG_FRASC Elongation factor G OS=Frankia sp. (strain CcI3) GN=fusA PE=3 SV=1 1 741 3.0E-91
sp|Q0RRS4|EFG_FRAAA Elongation factor G OS=Frankia alni (strain ACN14a) GN=fusA PE=3 SV=1 1 747 9.0E-91
sp|B6JET0|EFG_OLICO Elongation factor G OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=fusA PE=3 SV=1 1 738 1.0E-90
sp|Q89J81|EFG_BRADU Elongation factor G OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fusA PE=3 SV=1 1 738 2.0E-90
sp|A5ELN0|EFG_BRASB Elongation factor G OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=fusA PE=3 SV=1 1 738 2.0E-90
sp|Q82DQ1|EFG_STRAW Elongation factor G OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=fusA PE=3 SV=1 1 741 6.0E-90
sp|Q134S6|EFG_RHOPS Elongation factor G OS=Rhodopseudomonas palustris (strain BisB5) GN=fusA PE=3 SV=1 1 738 6.0E-90
sp|A4XBP9|EFG_SALTO Elongation factor G OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=fusA PE=3 SV=1 1 741 8.0E-90
sp|B3QBY3|EFG_RHOPT Elongation factor G OS=Rhodopseudomonas palustris (strain TIE-1) GN=fusA PE=3 SV=1 1 738 1.0E-89
sp|Q6N4T4|EFG_RHOPA Elongation factor G OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=fusA PE=3 SV=1 1 738 1.0E-89
sp|Q07KL5|EFG_RHOP5 Elongation factor G OS=Rhodopseudomonas palustris (strain BisA53) GN=fusA PE=3 SV=1 1 738 4.0E-89
sp|A6W5T4|EFG_KINRD Elongation factor G OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=fusA PE=3 SV=1 1 741 4.0E-89
sp|A6Q1M7|EFG_NITSB Elongation factor G OS=Nitratiruptor sp. (strain SB155-2) GN=fusA PE=3 SV=1 1 741 9.0E-89
sp|B3E7T2|EFG_GEOLS Elongation factor G OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=fusA PE=3 SV=1 1 741 2.0E-88
sp|A4T1R3|EFG_MYCGI Elongation factor G OS=Mycobacterium gilvum (strain PYR-GCK) GN=fusA PE=3 SV=1 1 741 2.0E-88
sp|Q9ZK24|EFG_HELPJ Elongation factor G OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=fusA PE=3 SV=3 1 741 2.0E-88
sp|Q1QN33|EFG_NITHX Elongation factor G OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=fusA PE=3 SV=1 1 738 2.0E-88
sp|Q1CS71|EFG_HELPH Elongation factor G OS=Helicobacter pylori (strain HPAG1) GN=fusA PE=3 SV=1 1 741 3.0E-88
sp|Q2IXR3|EFG_RHOP2 Elongation factor G OS=Rhodopseudomonas palustris (strain HaA2) GN=fusA PE=3 SV=1 1 738 3.0E-88
sp|B5Z8J0|EFG_HELPG Elongation factor G OS=Helicobacter pylori (strain G27) GN=fusA PE=3 SV=1 1 741 3.0E-88
sp|B2UUV6|EFG_HELPS Elongation factor G OS=Helicobacter pylori (strain Shi470) GN=fusA PE=3 SV=1 1 741 3.0E-88
sp|B6JN34|EFG_HELP2 Elongation factor G OS=Helicobacter pylori (strain P12) GN=fusA PE=3 SV=1 1 741 3.0E-88
sp|A8M532|EFG_SALAI Elongation factor G OS=Salinispora arenicola (strain CNS-205) GN=fusA PE=3 SV=1 1 741 5.0E-88
sp|P56002|EFG_HELPY Elongation factor G OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=fusA PE=3 SV=2 1 741 6.0E-88
sp|Q88XY8|EFG_LACPL Elongation factor G OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=fusA PE=3 SV=1 1 741 7.0E-88
sp|Q2RFP4|EFG_MOOTA Elongation factor G OS=Moorella thermoacetica (strain ATCC 39073) GN=fusA PE=3 SV=1 1 741 8.0E-88
sp|A5D5I7|EFG_PELTS Elongation factor G OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=fusA PE=3 SV=1 1 741 9.0E-88
sp|A7I3T6|EFG_CAMHC Elongation factor G OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=fusA PE=3 SV=1 1 741 9.0E-88
sp|Q17VN9|EFG_HELAH Elongation factor G OS=Helicobacter acinonychis (strain Sheeba) GN=fusA PE=3 SV=1 1 741 1.0E-87
sp|Q1BDD4|EFG_MYCSS Elongation factor G OS=Mycobacterium sp. (strain MCS) GN=fusA PE=3 SV=1 1 741 1.0E-87
sp|A1UBL0|EFG_MYCSK Elongation factor G OS=Mycobacterium sp. (strain KMS) GN=fusA PE=3 SV=1 1 741 1.0E-87
sp|A3PV95|EFG_MYCSJ Elongation factor G OS=Mycobacterium sp. (strain JLS) GN=fusA PE=3 SV=1 1 741 1.0E-87
sp|P40173|EFG1_STRCO Elongation factor G 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=fusA PE=3 SV=2 1 741 2.0E-87
sp|Q3SSW9|EFG_NITWN Elongation factor G OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=fusA PE=3 SV=1 1 738 3.0E-87
sp|A5FV42|EFG_ACICJ Elongation factor G OS=Acidiphilium cryptum (strain JF-5) GN=fusA PE=3 SV=1 1 741 3.0E-87
sp|A8LC59|EFG_FRASN Elongation factor G OS=Frankia sp. (strain EAN1pec) GN=fusA PE=3 SV=1 1 741 3.0E-87
sp|A5CUB7|EFG_CLAM3 Elongation factor G OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=fusA PE=3 SV=1 1 741 5.0E-87
sp|B5ELX6|EFG_ACIF5 Elongation factor G OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=fusA PE=3 SV=1 1 743 6.0E-87
sp|B7J464|EFG_ACIF2 Elongation factor G OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=fusA PE=3 SV=1 1 743 6.0E-87
sp|Q72I01|EFG_THET2 Elongation factor G OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=fusA PE=1 SV=1 1 741 1.0E-86
sp|Q83NA0|EFG_TROW8 Elongation factor G OS=Tropheryma whipplei (strain TW08/27) GN=fusA PE=3 SV=1 1 738 1.0E-86
sp|B8IS82|EFG_METNO Elongation factor G OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=fusA PE=3 SV=1 1 741 1.0E-86
sp|Q30Z38|EFG_DESAG Elongation factor G OS=Desulfovibrio alaskensis (strain G20) GN=fusA PE=3 SV=1 1 741 2.0E-86
sp|Q5YPG3|EFG_NOCFA Elongation factor G OS=Nocardia farcinica (strain IFM 10152) GN=fusA PE=3 SV=1 1 741 2.0E-86
sp|Q1WVA0|EFG_LACS1 Elongation factor G OS=Lactobacillus salivarius (strain UCC118) GN=fusA PE=3 SV=1 1 741 2.0E-86
sp|Q83FP1|EFG_TROWT Elongation factor G OS=Tropheryma whipplei (strain Twist) GN=fusA PE=3 SV=1 1 738 2.0E-86
sp|A8IAT3|EFG_AZOC5 Elongation factor G OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=fusA PE=3 SV=1 1 741 2.0E-86
sp|P13551|EFG_THETH Elongation factor G OS=Thermus thermophilus GN=fusA PE=1 SV=1 1 741 2.0E-86
sp|Q5SHN5|EFG_THET8 Elongation factor G OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=fusA PE=1 SV=1 1 741 2.0E-86
sp|Q0SFF3|EFG_RHOJR Elongation factor G OS=Rhodococcus jostii (strain RHA1) GN=fusA PE=3 SV=1 1 741 3.0E-86
sp|B0RB35|EFG_CLAMS Elongation factor G OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=fusA PE=3 SV=1 1 741 5.0E-86
sp|Q6ACY9|EFG_LEIXX Elongation factor G OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=fusA PE=3 SV=1 1 741 5.0E-86
sp|Q6NJD6|EFG_CORDI Elongation factor G OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=fusA PE=3 SV=2 1 741 6.0E-86
sp|C1A6Q2|EFG_GEMAT Elongation factor G OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=fusA PE=3 SV=1 1 741 6.0E-86
sp|Q5FUP6|EFG_GLUOX Elongation factor G OS=Gluconobacter oxydans (strain 621H) GN=fusA PE=3 SV=1 1 741 6.0E-86
sp|Q7VJ85|EFG_HELHP Elongation factor G OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=fusA PE=3 SV=1 1 741 7.0E-86
sp|C1AYS4|EFG_RHOOB Elongation factor G OS=Rhodococcus opacus (strain B4) GN=fusA PE=3 SV=1 1 741 8.0E-86
sp|B1W417|EFG_STRGG Elongation factor G OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=fusA PE=3 SV=1 1 741 8.0E-86
sp|Q83ES7|EFG_COXBU Elongation factor G OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fusA PE=3 SV=1 1 738 9.0E-86
sp|A9NAM1|EFG_COXBR Elongation factor G OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=fusA PE=3 SV=1 1 738 9.0E-86
sp|A8Z6I6|EFG_CAMC1 Elongation factor G OS=Campylobacter concisus (strain 13826) GN=fusA PE=3 SV=1 1 741 9.0E-86
sp|Q38UQ9|EFG_LACSS Elongation factor G OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=fusA PE=3 SV=1 1 741 9.0E-86
sp|A7GJ77|EFG_CLOBL Elongation factor G OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=fusA PE=3 SV=1 1 746 1.0E-85
sp|B1IGF7|EFG_CLOBK Elongation factor G OS=Clostridium botulinum (strain Okra / Type B1) GN=fusA PE=3 SV=1 1 746 1.0E-85
sp|A7HWQ8|EFG_PARL1 Elongation factor G OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=fusA PE=3 SV=1 1 741 1.0E-85
sp|Q0BSG5|EFG_GRABC Elongation factor G OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=fusA PE=3 SV=1 1 741 1.0E-85
sp|A5I7K9|EFG_CLOBH Elongation factor G OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=fusA PE=3 SV=1 1 746 1.0E-85
sp|A7FZ72|EFG_CLOB1 Elongation factor G OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=fusA PE=3 SV=1 1 746 1.0E-85
sp|A9KD34|EFG_COXBN Elongation factor G OS=Coxiella burnetii (strain Dugway 5J108-111) GN=fusA PE=3 SV=1 1 738 1.0E-85
sp|A7IFX8|EFG_XANP2 Elongation factor G OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=fusA PE=3 SV=1 1 741 1.0E-85
sp|A5V605|EFG_SPHWW Elongation factor G OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=fusA PE=3 SV=1 1 741 1.0E-85
sp|B0UHX2|EFG_METS4 Elongation factor G OS=Methylobacterium sp. (strain 4-46) GN=fusA PE=3 SV=1 1 741 1.0E-85
sp|B6J5C9|EFG_COXB1 Elongation factor G OS=Coxiella burnetii (strain CbuK_Q154) GN=fusA PE=3 SV=1 1 738 1.0E-85
sp|A1T4L5|EFG_MYCVP Elongation factor G OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=fusA PE=3 SV=1 1 741 2.0E-85
sp|Q74L90|EFG_LACJO Elongation factor G OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=fusA PE=3 SV=1 1 738 2.0E-85
sp|Q8FS85|EFG_COREF Elongation factor G OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=fusA PE=3 SV=2 1 741 2.0E-85
sp|B5EFP7|EFG_GEOBB Elongation factor G OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=fusA PE=3 SV=1 1 741 2.0E-85
sp|Q211E5|EFG_RHOPB Elongation factor G OS=Rhodopseudomonas palustris (strain BisB18) GN=fusA PE=3 SV=1 1 738 2.0E-85
sp|A9BHA8|EFG_PETMO Elongation factor G OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=fusA PE=3 SV=1 1 741 3.0E-85
sp|Q39Y09|EFG1_GEOMG Elongation factor G 1 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=fusA1 PE=3 SV=1 1 741 3.0E-85
sp|A7GZJ4|EFG_CAMC5 Elongation factor G OS=Campylobacter curvus (strain 525.92) GN=fusA PE=3 SV=1 1 741 3.0E-85
sp|Q1GP96|EFG_SPHAL Elongation factor G OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=fusA PE=3 SV=1 1 741 3.0E-85
sp|B6J266|EFG_COXB2 Elongation factor G OS=Coxiella burnetii (strain CbuG_Q212) GN=fusA PE=3 SV=1 1 738 4.0E-85
sp|C3PKP1|EFG_CORA7 Elongation factor G OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=fusA PE=3 SV=1 1 741 4.0E-85
sp|Q6AP74|EFG2_DESPS Elongation factor G 2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=fusA2 PE=3 SV=1 1 741 5.0E-85
sp|Q748Y8|EFG2_GEOSL Elongation factor G 2 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=fusA2 PE=3 SV=1 1 741 5.0E-85
sp|A1VEB9|EFG_DESVV Elongation factor G OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=fusA PE=3 SV=1 1 741 6.0E-85
sp|Q72CI3|EFG_DESVH Elongation factor G OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=fusA PE=3 SV=1 1 741 6.0E-85
sp|Q4AAQ6|EFG_MYCHJ Elongation factor G OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=fusA PE=3 SV=2 1 741 9.0E-85
sp|Q4A8T7|EFG_MYCH7 Elongation factor G OS=Mycoplasma hyopneumoniae (strain 7448) GN=fusA PE=3 SV=2 1 741 9.0E-85
sp|Q601W8|EFG_MYCH2 Elongation factor G OS=Mycoplasma hyopneumoniae (strain 232) GN=fusA PE=3 SV=1 1 741 9.0E-85
sp|Q73SD2|EFG_MYCPA Elongation factor G OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=fusA PE=3 SV=1 1 741 1.0E-84
sp|A0QL36|EFG_MYCA1 Elongation factor G OS=Mycobacterium avium (strain 104) GN=fusA PE=3 SV=1 1 741 1.0E-84
sp|B2GDX1|EFG_LACF3 Elongation factor G OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=fusA PE=3 SV=1 1 741 1.0E-84
sp|C3KVQ4|EFG_CLOB6 Elongation factor G OS=Clostridium botulinum (strain 657 / Type Ba4) GN=fusA PE=3 SV=1 1 746 1.0E-84
sp|B4U741|EFG_HYDS0 Elongation factor G OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=fusA PE=3 SV=1 1 745 2.0E-84
sp|Q5FM92|EFG_LACAC Elongation factor G OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=fusA PE=3 SV=1 1 738 2.0E-84
sp|C0ZVT6|EFG_RHOE4 Elongation factor G OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=fusA PE=3 SV=1 1 741 2.0E-84
sp|B9KHV3|EFG_ANAMF Elongation factor G OS=Anaplasma marginale (strain Florida) GN=fusA PE=3 SV=1 1 741 3.0E-84
sp|Q046C7|EFG_LACGA Elongation factor G OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=fusA PE=3 SV=1 1 738 4.0E-84
sp|Q5PBH2|EFG_ANAMM Elongation factor G OS=Anaplasma marginale (strain St. Maries) GN=fusA PE=3 SV=1 1 741 4.0E-84
sp|Q5ZYP6|EFG_LEGPH Elongation factor G OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=fusA PE=3 SV=1 1 738 6.0E-84
sp|A0M5A0|EFG_GRAFK Elongation factor G OS=Gramella forsetii (strain KT0803) GN=fusA PE=3 SV=1 1 738 6.0E-84
sp|A9W4P8|EFG_METEP Elongation factor G OS=Methylobacterium extorquens (strain PA1) GN=fusA PE=3 SV=1 1 741 7.0E-84
sp|B7L0Q8|EFG_METC4 Elongation factor G OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=fusA PE=3 SV=1 1 741 7.0E-84
sp|Q63WJ7|EFG1_BURPS Elongation factor G 1 OS=Burkholderia pseudomallei (strain K96243) GN=fusA1 PE=3 SV=1 1 738 8.0E-84
sp|Q62HK4|EFG1_BURMA Elongation factor G 1 OS=Burkholderia mallei (strain ATCC 23344) GN=fusA1 PE=3 SV=1 1 738 8.0E-84
sp|Q3JV86|EFG1_BURP1 Elongation factor G 1 OS=Burkholderia pseudomallei (strain 1710b) GN=fusA1 PE=3 SV=2 1 738 8.0E-84
sp|B1KSM8|EFG_CLOBM Elongation factor G OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=fusA PE=3 SV=1 1 746 9.0E-84
sp|C1FMV4|EFG_CLOBJ Elongation factor G OS=Clostridium botulinum (strain Kyoto / Type A2) GN=fusA PE=3 SV=1 1 746 9.0E-84
sp|C1F645|EFG_ACIC5 Elongation factor G OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=fusA PE=3 SV=1 1 739 9.0E-84
sp|Q5BJP6|RRF2M_RAT Ribosome-releasing factor 2, mitochondrial OS=Rattus norvegicus GN=Gfm2 PE=2 SV=2 1 749 1.0E-83
sp|Q5WZL5|EFG_LEGPL Elongation factor G OS=Legionella pneumophila (strain Lens) GN=fusA PE=3 SV=1 1 738 1.0E-83
sp|B2G8Y0|EFG_LACRJ Elongation factor G OS=Lactobacillus reuteri (strain JCM 1112) GN=fusA PE=3 SV=1 1 741 1.0E-83
sp|A5VLK8|EFG_LACRD Elongation factor G OS=Lactobacillus reuteri (strain DSM 20016) GN=fusA PE=3 SV=1 1 741 1.0E-83
sp|C0R543|EFG_WOLWR Elongation factor G OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=fusA PE=3 SV=1 1 741 1.0E-83
sp|Q73IX7|EFG_WOLPM Elongation factor G OS=Wolbachia pipientis wMel GN=fusA PE=3 SV=1 1 741 1.0E-83
sp|B3EUF3|EFG_AMOA5 Elongation factor G OS=Amoebophilus asiaticus (strain 5a2) GN=fusA PE=3 SV=1 1 741 1.0E-83
sp|A5IHR7|EFG_LEGPC Elongation factor G OS=Legionella pneumophila (strain Corby) GN=fusA PE=3 SV=1 1 738 1.0E-83
sp|Q0ANP7|EFG_MARMM Elongation factor G OS=Maricaulis maris (strain MCS10) GN=fusA PE=3 SV=1 1 741 2.0E-83
sp|A0RQI0|EFG_CAMFF Elongation factor G OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=fusA PE=3 SV=1 1 741 2.0E-83
sp|Q04ED6|EFG_OENOB Elongation factor G OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=fusA PE=3 SV=1 1 741 2.0E-83
sp|Q5X862|EFG_LEGPA Elongation factor G OS=Legionella pneumophila (strain Paris) GN=fusA PE=3 SV=1 1 738 2.0E-83
sp|Q8YP62|EFG_NOSS1 Elongation factor G OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=fusA PE=3 SV=1 1 741 2.0E-83
sp|Q8R2Q4|RRF2M_MOUSE Ribosome-releasing factor 2, mitochondrial OS=Mus musculus GN=Gfm2 PE=1 SV=2 1 749 3.0E-83
sp|B1LWS3|EFG_METRJ Elongation factor G OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=fusA PE=3 SV=1 1 741 3.0E-83
sp|Q1GBM0|EFG_LACDA Elongation factor G OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=fusA PE=3 SV=1 1 738 3.0E-83
sp|Q2W2I8|EFG_MAGSA Elongation factor G OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=fusA PE=3 SV=1 1 741 3.0E-83
sp|B1ZLK1|EFG_METPB Elongation factor G OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=fusA PE=3 SV=1 1 741 3.0E-83
sp|Q04C17|EFG_LACDB Elongation factor G OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=fusA PE=3 SV=1 1 738 4.0E-83
sp|Q7NAV3|EFG_MYCGA Elongation factor G OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=fusA PE=3 SV=2 1 738 4.0E-83
sp|Q8KTA8|EFG_RICFE Elongation factor G OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fusA PE=3 SV=2 1 741 4.0E-83
sp|B1MGH8|EFG_MYCA9 Elongation factor G OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=fusA PE=3 SV=1 1 741 5.0E-83
sp|Q2S3R7|EFG_SALRD Elongation factor G OS=Salinibacter ruber (strain DSM 13855 / M31) GN=fusA PE=3 SV=1 1 741 5.0E-83
sp|Q8R7V1|EFG_CALS4 Elongation factor G OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=fusA PE=3 SV=1 1 741 7.0E-83
sp|Q39DL2|EFG2_BURL3 Elongation factor G 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=fusA2 PE=3 SV=1 1 738 7.0E-83
sp|B8HD12|EFG_ARTCA Elongation factor G OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=fusA PE=3 SV=1 1 741 8.0E-83
sp|Q8KTB9|EFG_RICPA Elongation factor G OS=Rickettsia parkeri GN=fusA PE=3 SV=1 1 741 8.0E-83
sp|A4VSN3|EFG_STRSY Elongation factor G OS=Streptococcus suis (strain 05ZYH33) GN=fusA PE=3 SV=1 1 741 9.0E-83
sp|A4VYX6|EFG_STRS2 Elongation factor G OS=Streptococcus suis (strain 98HAH33) GN=fusA PE=3 SV=1 1 741 9.0E-83
sp|Q2T0I7|EFG1_BURTA Elongation factor G 1 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=fusA1 PE=3 SV=1 1 738 9.0E-83
sp|A4FPM8|EFG_SACEN Elongation factor G OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=fusA PE=3 SV=1 1 741 1.0E-82
sp|C3MAX7|EFG_RHISN Elongation factor G OS=Rhizobium sp. (strain NGR234) GN=fusA PE=3 SV=1 1 738 1.0E-82
sp|A1SNN6|EFG_NOCSJ Elongation factor G OS=Nocardioides sp. (strain BAA-499 / JS614) GN=fusA PE=3 SV=1 1 741 1.0E-82
sp|Q0AIJ8|EFG_NITEC Elongation factor G OS=Nitrosomonas eutropha (strain C91) GN=fusA PE=3 SV=1 1 738 1.0E-82
sp|A8YXK3|EFG_LACH4 Elongation factor G OS=Lactobacillus helveticus (strain DPC 4571) GN=fusA PE=3 SV=1 1 738 1.0E-82
sp|B1I1I5|EFG_DESAP Elongation factor G OS=Desulforudis audaxviator (strain MP104C) GN=fusA PE=3 SV=1 1 741 1.0E-82
sp|Q4JT40|EFG_CORJK Elongation factor G OS=Corynebacterium jeikeium (strain K411) GN=fusA PE=3 SV=1 1 741 1.0E-82
sp|B2GIL1|EFG_KOCRD Elongation factor G OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=fusA PE=3 SV=1 1 741 1.0E-82
sp|Q47LJ0|EFG_THEFY Elongation factor G OS=Thermobifida fusca (strain YX) GN=fusA PE=3 SV=1 1 741 1.0E-82
sp|Q2YB00|EFG_NITMU Elongation factor G OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=fusA PE=3 SV=1 1 738 1.0E-82
sp|B3CTE7|EFG_ORITI Elongation factor G OS=Orientia tsutsugamushi (strain Ikeda) GN=fusA PE=3 SV=1 1 741 2.0E-82
sp|C5C0J4|EFG_BEUC1 Elongation factor G OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=fusA PE=3 SV=1 1 741 2.0E-82
sp|B3CLA3|EFG_WOLPP Elongation factor G OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=fusA PE=3 SV=1 1 741 2.0E-82
sp|Q8DI43|EFG_THEEB Elongation factor G OS=Thermosynechococcus elongatus (strain BP-1) GN=fusA PE=3 SV=1 1 741 2.0E-82
sp|Q4FLL6|EFG_PELUB Elongation factor G OS=Pelagibacter ubique (strain HTCC1062) GN=fusA PE=3 SV=1 1 741 2.0E-82
sp|Q05FI2|EFG_CARRP Elongation factor G OS=Carsonella ruddii (strain PV) GN=fusA PE=3 SV=1 1 738 3.0E-82
sp|Q5GWS9|EFG_XANOR Elongation factor G OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=fusA PE=3 SV=2 1 739 3.0E-82
sp|Q2NZY2|EFG_XANOM Elongation factor G OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=fusA PE=3 SV=1 1 739 3.0E-82
sp|Q2GJ60|EFG_ANAPZ Elongation factor G OS=Anaplasma phagocytophilum (strain HZ) GN=fusA PE=3 SV=1 1 741 3.0E-82
sp|Q13UU8|EFG1_BURXL Elongation factor G 1 OS=Burkholderia xenovorans (strain LB400) GN=fusA1 PE=3 SV=1 1 738 3.0E-82
sp|Q98QD8|EFG_MYCPU Elongation factor G OS=Mycoplasma pulmonis (strain UAB CTIP) GN=fusA PE=3 SV=2 1 740 4.0E-82
sp|B9KFH1|EFG_CAMLR Elongation factor G OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=fusA PE=3 SV=1 1 741 4.0E-82
sp|Q8KTB0|EFG_RICBE Elongation factor G OS=Rickettsia bellii GN=fusA PE=3 SV=1 1 741 5.0E-82
sp|A8GV17|EFG_RICB8 Elongation factor G OS=Rickettsia bellii (strain OSU 85-389) GN=fusA PE=3 SV=1 1 741 5.0E-82
sp|A5CF23|EFG_ORITB Elongation factor G OS=Orientia tsutsugamushi (strain Boryong) GN=fusA PE=3 SV=1 1 741 5.0E-82
sp|B9K883|EFG_THENN Elongation factor G OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=fusA PE=3 SV=1 1 741 5.0E-82
sp|B7GJ64|EFG_ANOFW Elongation factor G OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=fusA PE=3 SV=1 1 741 6.0E-82
sp|Q5L400|EFG_GEOKA Elongation factor G OS=Geobacillus kaustophilus (strain HTA426) GN=fusA PE=3 SV=1 1 741 6.0E-82
sp|Q4FQG5|EFG_PSYA2 Elongation factor G OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=fusA PE=3 SV=1 1 741 6.0E-82
sp|B3PWR8|EFG_RHIE6 Elongation factor G OS=Rhizobium etli (strain CIAT 652) GN=fusA PE=3 SV=1 1 738 7.0E-82
sp|A1VYJ8|EFG_CAMJJ Elongation factor G OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=fusA PE=3 SV=1 1 741 7.0E-82
sp|B2J5B0|EFG_NOSP7 Elongation factor G OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=fusA PE=3 SV=1 1 741 8.0E-82
sp|B1GZ80|EFG_UNCTG Elongation factor G OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=fusA PE=3 SV=1 1 741 8.0E-82
sp|Q605A9|EFG2_METCA Elongation factor G 2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=fusA2 PE=3 SV=1 1 738 8.0E-82
sp|Q03IS1|EFG_STRTD Elongation factor G OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=fusA PE=3 SV=1 1 741 8.0E-82
sp|Q5M2M6|EFG_STRT2 Elongation factor G OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=fusA PE=3 SV=1 1 741 8.0E-82
sp|Q5LY21|EFG_STRT1 Elongation factor G OS=Streptococcus thermophilus (strain CNRZ 1066) GN=fusA PE=3 SV=1 1 741 8.0E-82
sp|B8DN94|EFG_DESVM Elongation factor G OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=fusA PE=3 SV=1 1 741 9.0E-82
sp|Q92J93|EFG_RICCN Elongation factor G OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fusA PE=3 SV=1 1 741 9.0E-82
sp|Q8E3E7|EFG_STRA3 Elongation factor G OS=Streptococcus agalactiae serotype III (strain NEM316) GN=fusA PE=3 SV=1 1 741 9.0E-82
sp|A6LLL0|EFG_THEM4 Elongation factor G OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=fusA PE=3 SV=1 1 744 1.0E-81
sp|A5USJ2|EFG_ROSS1 Elongation factor G OS=Roseiflexus sp. (strain RS-1) GN=fusA PE=3 SV=1 1 738 1.0E-81
sp|Q8PNS6|EFG_XANAC Elongation factor G OS=Xanthomonas axonopodis pv. citri (strain 306) GN=fusA PE=3 SV=1 1 739 1.0E-81
sp|Q3BWY7|EFG_XANC5 Elongation factor G OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=fusA PE=3 SV=1 1 739 1.0E-81
sp|C4K1P6|EFG_RICPU Elongation factor G OS=Rickettsia peacockii (strain Rustic) GN=fusA PE=3 SV=1 1 741 1.0E-81
sp|Q8KTB6|EFG_RICMO Elongation factor G OS=Rickettsia montanensis GN=fusA PE=3 SV=1 1 741 1.0E-81
sp|A7NR66|EFG_ROSCS Elongation factor G OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=fusA PE=3 SV=1 1 738 1.0E-81
sp|A3CQM2|EFG_STRSV Elongation factor G OS=Streptococcus sanguinis (strain SK36) GN=fusA PE=3 SV=1 1 741 2.0E-81
sp|B8HVR8|EFG_CYAP4 Elongation factor G OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=fusA PE=3 SV=1 1 741 2.0E-81
sp|I1K0K6|EFGC2_SOYBN Elongation factor G-2, chloroplastic OS=Glycine max GN=fusA2 PE=3 SV=1 1 741 2.0E-81
sp|Q8KTB8|EFG_RICSI Elongation factor G OS=Rickettsia sibirica GN=fusA PE=3 SV=1 1 741 2.0E-81
sp|Q3MDM4|EFG_ANAVT Elongation factor G OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=fusA PE=3 SV=1 1 741 2.0E-81
sp|B2HSL2|EFG_MYCMM Elongation factor G OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fusA PE=3 SV=1 1 741 2.0E-81
sp|Q9PJV6|EFG_CHLMU Elongation factor G OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fusA PE=3 SV=1 1 741 3.0E-81
sp|Q92QH2|EFG_RHIME Elongation factor G OS=Rhizobium meliloti (strain 1021) GN=fusA PE=3 SV=1 1 738 3.0E-81
sp|Q9PA90|EFG_XYLFA Elongation factor G OS=Xylella fastidiosa (strain 9a5c) GN=fusA PE=3 SV=1 1 739 3.0E-81
sp|P74228|EFG2_SYNY3 Elongation factor G 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fusB PE=3 SV=1 1 741 3.0E-81
sp|C5CC67|EFG_MICLC Elongation factor G OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=fusA PE=3 SV=1 1 741 3.0E-81
sp|A0PM41|EFG_MYCUA Elongation factor G OS=Mycobacterium ulcerans (strain Agy99) GN=fusA PE=3 SV=1 1 741 3.0E-81
sp|Q8DXS7|EFG_STRA5 Elongation factor G OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=fusA PE=3 SV=1 1 741 3.0E-81
sp|Q3JZB5|EFG_STRA1 Elongation factor G OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=fusA PE=3 SV=1 1 741 3.0E-81
sp|Q1AU26|EFG_RUBXD Elongation factor G OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=fusA PE=3 SV=1 1 741 3.0E-81
sp|Q87A35|EFG_XYLFT Elongation factor G OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=fusA PE=3 SV=1 1 739 3.0E-81
sp|B2IA64|EFG_XYLF2 Elongation factor G OS=Xylella fastidiosa (strain M23) GN=fusA PE=3 SV=1 1 739 3.0E-81
sp|Q1H4P0|EFG_METFK Elongation factor G OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=fusA PE=3 SV=1 1 738 3.0E-81
sp|Q1BU86|EFG1_BURCA Elongation factor G 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=fusA1 PE=3 SV=2 1 738 4.0E-81
sp|Q7Q3I6|RRF2M_ANOGA Ribosome-releasing factor 2, mitochondrial OS=Anopheles gambiae GN=AGAP007894 PE=3 SV=4 1 734 4.0E-81
sp|Q2GFN5|EFG_EHRCR Elongation factor G OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=fusA PE=3 SV=1 1 741 4.0E-81
sp|Q03PV4|EFG_LACBA Elongation factor G OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=fusA PE=3 SV=1 1 739 4.0E-81
sp|A6Q6I6|EFG_SULNB Elongation factor G OS=Sulfurovum sp. (strain NBC37-1) GN=fusA PE=3 SV=1 1 741 4.0E-81
sp|Q65PB0|EFG_BACLD Elongation factor G OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=fusA PE=3 SV=1 1 741 4.0E-81
sp|Q2JUX5|EFG_SYNJA Elongation factor G OS=Synechococcus sp. (strain JA-3-3Ab) GN=fusA PE=3 SV=1 1 741 5.0E-81
sp|B0S0I4|EFG_FINM2 Elongation factor G OS=Finegoldia magna (strain ATCC 29328) GN=fusA PE=3 SV=1 1 741 5.0E-81
sp|Q1RHC3|EFG_RICBR Elongation factor G OS=Rickettsia bellii (strain RML369-C) GN=fusA PE=3 SV=1 1 741 5.0E-81
sp|Q2K9L9|EFG_RHIEC Elongation factor G OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=fusA PE=3 SV=1 1 738 6.0E-81
sp|Q7MTL1|EFG_PORGI Elongation factor G OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=fusA PE=3 SV=1 1 741 6.0E-81
sp|Q8KTB7|EFG_RICRH Elongation factor G OS=Rickettsia rhipicephali GN=fusA PE=3 SV=1 1 741 7.0E-81
sp|Q8KTC1|EFG_RICRI Elongation factor G OS=Rickettsia rickettsii GN=fusA PE=3 SV=1 1 741 7.0E-81
sp|Q8KTB4|EFG_RICHE Elongation factor G OS=Rickettsia helvetica GN=fusA PE=3 SV=1 1 741 7.0E-81
sp|C3PMH0|EFG_RICAE Elongation factor G OS=Rickettsia africae (strain ESF-5) GN=fusA PE=3 SV=1 1 741 7.0E-81
sp|A6U856|EFG_SINMW Elongation factor G OS=Sinorhizobium medicae (strain WSM419) GN=fusA PE=3 SV=1 1 738 7.0E-81
sp|A4G9U1|EFG_HERAR Elongation factor G OS=Herminiimonas arsenicoxydans GN=fusA PE=3 SV=1 1 738 8.0E-81
sp|Q5HVX6|EFG_CAMJR Elongation factor G OS=Campylobacter jejuni (strain RM1221) GN=fusA PE=3 SV=1 1 741 9.0E-81
sp|Q9PI16|EFG_CAMJE Elongation factor G OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=fusA PE=3 SV=1 1 741 9.0E-81
sp|A8FKR7|EFG_CAMJ8 Elongation factor G OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=fusA PE=3 SV=1 1 741 9.0E-81
sp|Q969S9|RRF2M_HUMAN Ribosome-releasing factor 2, mitochondrial OS=Homo sapiens GN=GFM2 PE=1 SV=1 1 738 9.0E-81
sp|Q88FI4|EFG2_PSEPK Elongation factor G 2 OS=Pseudomonas putida (strain KT2440) GN=fusB PE=3 SV=1 1 738 1.0E-80
sp|B3QR64|EFG_CHLP8 Elongation factor G OS=Chlorobaculum parvum (strain NCIB 8327) GN=fusA PE=3 SV=1 1 741 1.0E-80
sp|B4JSI3|RRF2M_DROGR Ribosome-releasing factor 2, mitochondrial OS=Drosophila grimshawi GN=EF-G2 PE=3 SV=1 1 734 1.0E-80
sp|B2RLZ4|EFG_PORG3 Elongation factor G OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=fusA PE=3 SV=1 1 741 1.0E-80
sp|B0BC74|EFG_CHLTB Elongation factor G OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=fusA PE=3 SV=1 1 741 1.0E-80
sp|A5IM80|EFG_THEP1 Elongation factor G OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=fusA PE=3 SV=1 1 741 1.0E-80
sp|C1CIF3|EFG_STRZP Elongation factor G OS=Streptococcus pneumoniae (strain P1031) GN=fusA PE=3 SV=1 1 741 1.0E-80
sp|B0U5X3|EFG_XYLFM Elongation factor G OS=Xylella fastidiosa (strain M12) GN=fusA PE=3 SV=1 1 739 1.0E-80
sp|A2S7H3|EFG_BURM9 Elongation factor G OS=Burkholderia mallei (strain NCTC 10229) GN=fusA PE=3 SV=1 1 738 1.0E-80
sp|Q2SU24|EFG2_BURTA Elongation factor G 2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=fusA2 PE=3 SV=1 1 738 1.0E-80
sp|Q63Q08|EFG2_BURPS Elongation factor G 2 OS=Burkholderia pseudomallei (strain K96243) GN=fusA2 PE=3 SV=1 1 738 1.0E-80
sp|Q3JMR0|EFG2_BURP1 Elongation factor G 2 OS=Burkholderia pseudomallei (strain 1710b) GN=fusA2 PE=3 SV=1 1 738 1.0E-80
sp|Q62GK2|EFG2_BURMA Elongation factor G 2 OS=Burkholderia mallei (strain ATCC 23344) GN=fusA2 PE=3 SV=1 1 738 1.0E-80
sp|A8F0P0|EFG_RICM5 Elongation factor G OS=Rickettsia massiliae (strain Mtu5) GN=fusA PE=3 SV=2 1 741 1.0E-80
sp|Q5NQ66|EFG_ZYMMO Elongation factor G OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=fusA PE=3 SV=1 1 741 2.0E-80
sp|B5ZYT2|EFG_RHILW Elongation factor G OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=fusA PE=3 SV=1 1 741 2.0E-80
sp|A8GQV7|EFG_RICRS Elongation factor G OS=Rickettsia rickettsii (strain Sheila Smith) GN=fusA PE=3 SV=1 1 741 2.0E-80
sp|B0BWA2|EFG_RICRO Elongation factor G OS=Rickettsia rickettsii (strain Iowa) GN=fusA PE=3 SV=1 1 741 2.0E-80
sp|Q1Q8P1|EFG_PSYCK Elongation factor G OS=Psychrobacter cryohalolentis (strain K5) GN=fusA PE=3 SV=1 1 741 2.0E-80
sp|B2V7L6|EFG_SULSY Elongation factor G OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=fusA PE=3 SV=1 1 741 2.0E-80
sp|Q82T70|EFG_NITEU Elongation factor G OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=fusA PE=3 SV=1 1 738 2.0E-80
sp|B9JDS6|EFG_AGRRK Elongation factor G OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=fusA PE=3 SV=1 1 738 2.0E-80
sp|P64023|EFG_STRR6 Elongation factor G OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=fusA PE=3 SV=1 1 741 2.0E-80
sp|P64022|EFG_STRPN Elongation factor G OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=fusA PE=3 SV=1 1 741 2.0E-80
sp|C1CB46|EFG_STRP7 Elongation factor G OS=Streptococcus pneumoniae (strain 70585) GN=fusA PE=3 SV=1 1 741 2.0E-80
sp|B5E6U5|EFG_STRP4 Elongation factor G OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=fusA PE=3 SV=1 1 741 2.0E-80
sp|Q04MH7|EFG_STRP2 Elongation factor G OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=fusA PE=3 SV=1 1 741 2.0E-80
sp|B3EP64|EFG_CHLPB Elongation factor G OS=Chlorobium phaeobacteroides (strain BS1) GN=fusA PE=3 SV=1 1 741 2.0E-80
sp|Q3YSU3|EFG_EHRCJ Elongation factor G OS=Ehrlichia canis (strain Jake) GN=fusA PE=3 SV=1 1 741 2.0E-80
sp|B3WAM2|EFG_LACCB Elongation factor G OS=Lactobacillus casei (strain BL23) GN=fusA PE=3 SV=1 1 741 2.0E-80
sp|P18667|EFG_SYNP6 Elongation factor G OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=fusA PE=3 SV=1 1 741 2.0E-80
sp|Q31PV4|EFG_SYNE7 Elongation factor G OS=Synechococcus elongatus (strain PCC 7942) GN=fusA PE=3 SV=1 1 741 2.0E-80
sp|B8DTV6|EFG_BIFA0 Elongation factor G OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=fusA PE=3 SV=1 1 741 2.0E-80
sp|P30767|EFG_MYCLE Elongation factor G OS=Mycobacterium leprae (strain TN) GN=fusA PE=3 SV=2 1 741 3.0E-80
sp|B8ZSC2|EFG_MYCLB Elongation factor G OS=Mycobacterium leprae (strain Br4923) GN=fusA PE=3 SV=1 1 741 3.0E-80
sp|Q1D777|EFG2_MYXXD Elongation factor G 2 OS=Myxococcus xanthus (strain DK 1622) GN=fusA2 PE=3 SV=1 1 738 3.0E-80
sp|A4QBG9|EFG_CORGB Elongation factor G OS=Corynebacterium glutamicum (strain R) GN=fusA PE=3 SV=1 1 741 3.0E-80
sp|Q30TP3|EFG_SULDN Elongation factor G OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=fusA PE=3 SV=1 1 741 3.0E-80
sp|B2IK59|EFG_BEII9 Elongation factor G OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=fusA PE=3 SV=1 1 741 3.0E-80
sp|A8GMA0|EFG_RICAH Elongation factor G OS=Rickettsia akari (strain Hartford) GN=fusA PE=3 SV=1 1 741 3.0E-80
sp|O84444|EFG_CHLTR Elongation factor G OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fusA PE=3 SV=1 1 741 3.0E-80
sp|Q3KLR3|EFG_CHLTA Elongation factor G OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=fusA PE=3 SV=1 1 741 3.0E-80
sp|A7H4P5|EFG_CAMJD Elongation factor G OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=fusA PE=3 SV=1 1 741 3.0E-80
sp|Q1IX68|EFG_DEIGD Elongation factor G OS=Deinococcus geothermalis (strain DSM 11300) GN=fusA PE=3 SV=1 1 741 4.0E-80
sp|B3QY21|EFG_CHLT3 Elongation factor G OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=fusA PE=3 SV=1 1 741 4.0E-80
sp|P38525|EFG_THEMA Elongation factor G OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fusA PE=3 SV=2 1 741 4.0E-80
sp|Q2JMX8|EFG_SYNJB Elongation factor G OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=fusA PE=3 SV=1 1 741 4.0E-80
sp|B1LBP3|EFG_THESQ Elongation factor G OS=Thermotoga sp. (strain RQ2) GN=fusA PE=3 SV=1 1 741 5.0E-80
sp|A2RP72|EFG_LACLM Elongation factor G OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=fusA PE=3 SV=1 1 741 5.0E-80
sp|A8F981|EFG_BACP2 Elongation factor G OS=Bacillus pumilus (strain SAFR-032) GN=fusA PE=3 SV=1 1 741 5.0E-80
sp|B0B809|EFG_CHLT2 Elongation factor G OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=fusA PE=3 SV=1 1 741 5.0E-80
sp|A8AUR6|EFG_STRGC Elongation factor G OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=fusA PE=3 SV=1 1 741 5.0E-80
sp|A4XI36|EFG_CALS8 Elongation factor G OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=fusA PE=3 SV=1 1 741 5.0E-80
sp|A4SCQ6|EFG_CHLPM Elongation factor G OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=fusA PE=3 SV=1 1 741 5.0E-80
sp|Q8NT19|EFG_CORGL Elongation factor G OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=fusA PE=3 SV=1 1 741 5.0E-80
sp|Q1BRU5|EFG2_BURCA Elongation factor G 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=fusA2 PE=3 SV=1 1 738 6.0E-80
sp|B2A4D6|EFG_NATTJ Elongation factor G OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=fusA PE=3 SV=1 1 741 6.0E-80
sp|B3PME9|EFG_MYCA5 Elongation factor G OS=Mycoplasma arthritidis (strain 158L3-1) GN=fusA PE=3 SV=1 1 741 6.0E-80
sp|B1I8Z9|EFG_STRPI Elongation factor G OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=fusA PE=3 SV=1 1 741 6.0E-80
sp|B9DVS2|EFG_STRU0 Elongation factor G OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=fusA PE=3 SV=1 1 741 6.0E-80
sp|Q9CDG1|EFG_LACLA Elongation factor G OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=fusA PE=3 SV=1 1 741 7.0E-80
sp|B4EYV7|EFG_PROMH Elongation factor G OS=Proteus mirabilis (strain HI4320) GN=fusA PE=3 SV=1 1 739 7.0E-80
sp|B8ZKU0|EFG_STRPJ Elongation factor G OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=fusA PE=3 SV=1 1 741 7.0E-80
sp|C1CC62|EFG_STRZJ Elongation factor G OS=Streptococcus pneumoniae (strain JJA) GN=fusA PE=3 SV=1 1 741 7.0E-80
sp|C1CPE5|EFG_STRZT Elongation factor G OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=fusA PE=3 SV=1 1 741 8.0E-80
sp|B2ISJ9|EFG_STRPS Elongation factor G OS=Streptococcus pneumoniae (strain CGSP14) GN=fusA PE=3 SV=1 1 741 8.0E-80
sp|Q98N59|EFG_RHILO Elongation factor G OS=Rhizobium loti (strain MAFF303099) GN=fusA PE=3 SV=1 1 741 8.0E-80
sp|C5D3R4|EFG_GEOSW Elongation factor G OS=Geobacillus sp. (strain WCH70) GN=fusA PE=3 SV=1 1 741 1.0E-79
sp|A1A0T0|EFG_BIFAA Elongation factor G OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=fusA PE=3 SV=1 1 741 1.0E-79
sp|B9MQH0|EFG_CALBD Elongation factor G OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=fusA PE=3 SV=1 1 741 1.0E-79
sp|Q1ISC5|EFG_KORVE Elongation factor G OS=Koribacter versatilis (strain Ellin345) GN=fusA PE=3 SV=1 1 739 1.0E-79
sp|Q123W3|EFG2_POLSJ Elongation factor G 2 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=fusA2 PE=3 SV=1 1 738 1.0E-79
sp|P34811|EFGC1_SOYBN Elongation factor G-1, chloroplastic OS=Glycine max GN=fusA1 PE=3 SV=2 1 741 1.0E-79
sp|A1W2Q4|EFG_ACISJ Elongation factor G OS=Acidovorax sp. (strain JS42) GN=fusA PE=3 SV=1 1 738 1.0E-79
sp|Q6MJ13|EFG1_BDEBA Elongation factor G 1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=fusA1 PE=3 SV=1 1 744 1.0E-79
sp|B7IT16|EFG_BACC2 Elongation factor G OS=Bacillus cereus (strain G9842) GN=fusA PE=3 SV=1 1 741 1.0E-79
sp|Q9Z9L7|EFG_BACHD Elongation factor G OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=fusA PE=3 SV=2 1 741 1.0E-79
sp|Q034X8|EFG_LACC3 Elongation factor G OS=Lactobacillus casei (strain ATCC 334) GN=fusA PE=3 SV=1 1 741 1.0E-79
sp|B9MB70|EFG_ACIET Elongation factor G OS=Acidovorax ebreus (strain TPSY) GN=fusA PE=3 SV=1 1 738 1.0E-79
sp|Q5R600|RRF2M_PONAB Ribosome-releasing factor 2, mitochondrial OS=Pongo abelii GN=GFM2 PE=2 SV=1 1 737 1.0E-79
sp|Q0SMG2|EFG2_BORAP Elongation factor G 2 OS=Borrelia afzelii (strain PKo) GN=fusA2 PE=3 SV=1 1 490 2.0E-79
sp|Q9I244|EFG2_PSEAE Elongation factor G 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fusB PE=3 SV=1 1 749 2.0E-79
sp|B8D0C1|EFG_HALOH Elongation factor G OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=fusA PE=3 SV=1 1 741 2.0E-79
sp|Q2L2H1|EFG1_BORA1 Elongation factor G 1 OS=Bordetella avium (strain 197N) GN=fusA1 PE=3 SV=1 1 747 2.0E-79
sp|Q9SI75|EFGC_ARATH Elongation factor G, chloroplastic OS=Arabidopsis thaliana GN=CPEFG PE=1 SV=1 1 741 2.0E-79
sp|Q8KAG9|EFG_CHLTE Elongation factor G OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=fusA-1 PE=3 SV=1 1 741 2.0E-79
sp|A4IJI6|EFG_GEOTN Elongation factor G OS=Geobacillus thermodenitrificans (strain NG80-2) GN=fusA PE=3 SV=1 1 741 2.0E-79
sp|B7IHU3|EFG_THEAB Elongation factor G OS=Thermosipho africanus (strain TCF52B) GN=fusA PE=3 SV=1 1 744 2.0E-79
sp|Q8UE15|EFG_AGRFC Elongation factor G OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=fusA PE=3 SV=1 1 741 2.0E-79
sp|Q01W89|EFG_SOLUE Elongation factor G OS=Solibacter usitatus (strain Ellin6076) GN=fusA PE=3 SV=1 1 741 3.0E-79
sp|Q4A703|EFG_MYCS5 Elongation factor G OS=Mycoplasma synoviae (strain 53) GN=fusA PE=3 SV=1 1 740 3.0E-79
sp|Q8K948|EFG_BUCAP Elongation factor G OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fusA PE=3 SV=1 1 747 3.0E-79
sp|B8ELG6|EFG_METSB Elongation factor G OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=fusA PE=3 SV=1 1 741 3.0E-79
sp|B0UWC4|EFG_HISS2 Elongation factor G OS=Histophilus somni (strain 2336) GN=fusA PE=3 SV=1 1 734 3.0E-79
sp|Q0I537|EFG_HAES1 Elongation factor G OS=Haemophilus somnus (strain 129Pt) GN=fusA PE=3 SV=1 1 734 3.0E-79
sp|B4NAU8|RRF2M_DROWI Ribosome-releasing factor 2, mitochondrial OS=Drosophila willistoni GN=EF-G2 PE=3 SV=1 1 734 3.0E-79
sp|B1HMZ1|EFG_LYSSC Elongation factor G OS=Lysinibacillus sphaericus (strain C3-41) GN=fusA PE=3 SV=1 1 741 3.0E-79
sp|Q5GSU1|EFG_WOLTR Elongation factor G OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=fusA PE=3 SV=1 1 741 3.0E-79
sp|Q2IJ93|EFG1_ANADE Elongation factor G 1 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=fusA1 PE=3 SV=1 1 741 3.0E-79
sp|B4S5N0|EFG_PROA2 Elongation factor G OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=fusA PE=3 SV=1 1 741 3.0E-79
sp|B1MW21|EFG_LEUCK Elongation factor G OS=Leuconostoc citreum (strain KM20) GN=fusA PE=3 SV=1 1 741 3.0E-79
sp|Q492B1|EFG_BLOPB Elongation factor G OS=Blochmannia pennsylvanicus (strain BPEN) GN=fusA PE=3 SV=1 1 741 3.0E-79
sp|Q1MIE4|EFG_RHIL3 Elongation factor G OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=fusA PE=3 SV=1 1 741 4.0E-79
sp|Q8PC52|EFG_XANCP Elongation factor G OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=fusA PE=3 SV=1 1 739 4.0E-79
sp|B0RU85|EFG_XANCB Elongation factor G OS=Xanthomonas campestris pv. campestris (strain B100) GN=fusA PE=3 SV=1 1 739 4.0E-79
sp|Q4URD6|EFG_XANC8 Elongation factor G OS=Xanthomonas campestris pv. campestris (strain 8004) GN=fusA PE=3 SV=1 1 739 4.0E-79
sp|C4KZQ0|EFG_EXISA Elongation factor G OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=fusA PE=3 SV=1 1 741 4.0E-79
sp|B5XJR1|EFG_STRPZ Elongation factor G OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=fusA PE=3 SV=1 1 741 5.0E-79
sp|Q8G5B6|EFG_BIFLO Elongation factor G OS=Bifidobacterium longum (strain NCC 2705) GN=fusA PE=3 SV=1 1 741 5.0E-79
sp|B3DT30|EFG_BIFLD Elongation factor G OS=Bifidobacterium longum (strain DJO10A) GN=fusA PE=3 SV=1 1 741 5.0E-79
sp|Q97EH4|EFG_CLOAB Elongation factor G OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=fusA PE=3 SV=1 1 741 5.0E-79
sp|Q5HC12|EFG_EHRRW Elongation factor G OS=Ehrlichia ruminantium (strain Welgevonden) GN=fusA PE=3 SV=1 1 741 6.0E-79
sp|Q5FFE7|EFG_EHRRG Elongation factor G OS=Ehrlichia ruminantium (strain Gardel) GN=fusA PE=3 SV=1 1 741 6.0E-79
sp|B4U0V9|EFG_STREM Elongation factor G OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=fusA PE=3 SV=1 1 741 6.0E-79
sp|C0MF25|EFG_STRS7 Elongation factor G OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=fusA PE=3 SV=1 1 741 6.0E-79
sp|C0M937|EFG_STRE4 Elongation factor G OS=Streptococcus equi subsp. equi (strain 4047) GN=fusA PE=3 SV=1 1 741 6.0E-79
sp|A6QNM2|RRF2M_BOVIN Ribosome-releasing factor 2, mitochondrial OS=Bos taurus GN=GFM2 PE=2 SV=1 1 738 6.0E-79
sp|A7Z0N4|EFG_BACMF Elongation factor G OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=fusA PE=3 SV=1 1 741 6.0E-79
sp|Q814C5|EFG_BACCR Elongation factor G OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=fusA PE=3 SV=1 1 741 8.0E-79
sp|B7HJ45|EFG_BACC4 Elongation factor G OS=Bacillus cereus (strain B4264) GN=fusA PE=3 SV=1 1 741 8.0E-79
sp|Q11HP9|EFG_CHESB Elongation factor G OS=Chelativorans sp. (strain BNC1) GN=fusA PE=3 SV=1 1 741 9.0E-79
sp|A0JMI9|RRF2M_DANRE Ribosome-releasing factor 2, mitochondrial OS=Danio rerio GN=gfm2 PE=2 SV=2 1 739 9.0E-79
sp|Q2GD82|EFG_NEOSM Elongation factor G OS=Neorickettsia sennetsu (strain Miyayama) GN=fusA PE=3 SV=1 1 741 9.0E-79
sp|A9VP74|EFG_BACWK Elongation factor G OS=Bacillus weihenstephanensis (strain KBAB4) GN=fusA PE=3 SV=1 1 741 1.0E-78
sp|Q13TG7|EFG2_BURXL Elongation factor G 2 OS=Burkholderia xenovorans (strain LB400) GN=fusA2 PE=3 SV=1 1 738 1.0E-78
sp|C3LJ79|EFG_BACAC Elongation factor G OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=fusA PE=3 SV=1 1 741 1.0E-78
sp|P0DA85|EFG_STRPQ Elongation factor G OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=fus PE=3 SV=1 1 741 1.0E-78
sp|Q48VB6|EFG_STRPM Elongation factor G OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=fusA PE=3 SV=1 1 741 1.0E-78
sp|Q1J8I4|EFG_STRPF Elongation factor G OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=fusA PE=3 SV=1 1 741 1.0E-78
sp|Q1JIM6|EFG_STRPD Elongation factor G OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=fusA PE=3 SV=1 1 741 1.0E-78
sp|Q1JNH7|EFG_STRPC Elongation factor G OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=fusA PE=3 SV=1 1 741 1.0E-78
sp|P69948|EFG_STRP8 Elongation factor G OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=fus PE=3 SV=2 1 741 1.0E-78
sp|Q5XDW4|EFG_STRP6 Elongation factor G OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=fus PE=1 SV=3 1 741 1.0E-78
sp|P0DA84|EFG_STRP3 Elongation factor G OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=fus PE=3 SV=1 1 741 1.0E-78
sp|P69946|EFG_STRP1 Elongation factor G OS=Streptococcus pyogenes serotype M1 GN=fus PE=3 SV=2 1 741 1.0E-78
sp|P75544|EFG_MYCPN Elongation factor G OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=fusA PE=3 SV=1 1 738 1.0E-78
sp|Q6F0J4|EFG_MESFL Elongation factor G OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=fusA PE=3 SV=1 1 738 1.0E-78
sp|B0TC53|EFG_HELMI Elongation factor G OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=fusA PE=3 SV=1 1 741 1.0E-78
sp|B0K5P0|EFG_THEPX Elongation factor G OS=Thermoanaerobacter sp. (strain X514) GN=fusA PE=3 SV=1 1 741 2.0E-78
sp|B0KCJ7|EFG_THEP3 Elongation factor G OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=fusA PE=3 SV=1 1 741 2.0E-78
sp|C1CXH0|EFG_DEIDV Elongation factor G OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=fusA PE=3 SV=1 1 741 2.0E-78
sp|C5BGM8|EFG_EDWI9 Elongation factor G OS=Edwardsiella ictaluri (strain 93-146) GN=fusA PE=3 SV=1 1 735 2.0E-78
sp|Q9RXK5|EFG_DEIRA Elongation factor G OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=fusA PE=3 SV=1 1 741 2.0E-78
sp|A7HM55|EFG_FERNB Elongation factor G OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=fusA PE=3 SV=1 1 741 2.0E-78
sp|Q6A6L5|EFG_PROAC Elongation factor G OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=fusA PE=3 SV=1 1 738 2.0E-78
sp|Q2KV83|EFG2_BORA1 Elongation factor G 2 OS=Bordetella avium (strain 197N) GN=fusA2 PE=3 SV=1 1 738 2.0E-78
sp|Q63H93|EFG_BACCZ Elongation factor G OS=Bacillus cereus (strain ZK / E33L) GN=fusA PE=3 SV=1 1 741 2.0E-78
sp|A0ALY9|EFG_LISW6 Elongation factor G OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=fusA PE=3 SV=1 1 741 2.0E-78
sp|Q8Y421|EFG_LISMO Elongation factor G OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=fusA PE=3 SV=1 1 741 2.0E-78
sp|B8DAY6|EFG_LISMH Elongation factor G OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=fusA PE=3 SV=1 1 741 2.0E-78
sp|Q71WB8|EFG_LISMF Elongation factor G OS=Listeria monocytogenes serotype 4b (strain F2365) GN=fusA PE=3 SV=1 1 741 2.0E-78
sp|C1KZK7|EFG_LISMC Elongation factor G OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=fusA PE=3 SV=1 1 741 2.0E-78
sp|Q7VNA2|EFG_HAEDU Elongation factor G OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=fusA PE=3 SV=1 1 734 2.0E-78
sp|P13550|EFG_ARTPT Elongation factor G OS=Arthrospira platensis GN=fusA PE=3 SV=1 1 741 2.0E-78
sp|B9L7K0|EFG_NAUPA Elongation factor G OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=fusA PE=3 SV=1 1 741 2.0E-78
sp|P09952|EFG_MICLU Elongation factor G OS=Micrococcus luteus GN=fusA PE=3 SV=1 2 741 2.0E-78
sp|Q5WLR5|EFG_BACSK Elongation factor G OS=Bacillus clausii (strain KSM-K16) GN=fusA PE=3 SV=1 1 741 2.0E-78
sp|B9IZJ1|EFG_BACCQ Elongation factor G OS=Bacillus cereus (strain Q1) GN=fusA PE=3 SV=1 1 741 3.0E-78
sp|B7HQU1|EFG_BACC7 Elongation factor G OS=Bacillus cereus (strain AH187) GN=fusA PE=3 SV=1 1 741 3.0E-78
sp|O51634|EFG2_BORBU Elongation factor G 2 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=fusB PE=3 SV=1 1 490 3.0E-78
sp|B1Y7G9|EFG_LEPCP Elongation factor G OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=fusA PE=3 SV=1 1 738 3.0E-78
sp|Q7U4D2|EFG_SYNPX Elongation factor G OS=Synechococcus sp. (strain WH8102) GN=fusA PE=3 SV=1 1 741 3.0E-78
sp|Q2SSW9|EFG_MYCCT Elongation factor G OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=fusA PE=3 SV=1 1 738 3.0E-78
sp|A9WSW6|EFG_RENSM Elongation factor G OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=fusA PE=3 SV=1 1 741 4.0E-78
sp|B1VET0|EFG_CORU7 Elongation factor G OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=fusA PE=3 SV=1 1 741 4.0E-78
sp|A5CXN7|EFG_VESOH Elongation factor G OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=fusA PE=3 SV=1 1 738 4.0E-78
sp|Q6HPR1|EFG_BACHK Elongation factor G OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=fusA PE=3 SV=1 1 741 4.0E-78
sp|C1ET36|EFG_BACC3 Elongation factor G OS=Bacillus cereus (strain 03BB102) GN=fusA PE=3 SV=1 1 741 4.0E-78
sp|Q81VT3|EFG_BACAN Elongation factor G OS=Bacillus anthracis GN=fusA PE=3 SV=1 1 741 4.0E-78
sp|C3P9Q2|EFG_BACAA Elongation factor G OS=Bacillus anthracis (strain A0248) GN=fusA PE=3 SV=1 1 741 4.0E-78
sp|A7GK17|EFG_BACCN Elongation factor G OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=fusA PE=3 SV=1 1 741 4.0E-78
sp|Q73R08|EFG1_TREDE Elongation factor G 1 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=fusA1 PE=3 SV=1 1 739 4.0E-78
sp|A2RCI2|EFG_STRPG Elongation factor G OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=fusA PE=3 SV=1 1 741 4.0E-78
sp|Q5L6S5|EFG_CHLAB Elongation factor G OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=fusA PE=3 SV=1 1 741 5.0E-78
sp|P57938|EFG_PASMU Elongation factor G OS=Pasteurella multocida (strain Pm70) GN=fusA PE=3 SV=1 1 734 5.0E-78
sp|A6LPQ8|EFG_CLOB8 Elongation factor G OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=fusA PE=3 SV=1 1 741 5.0E-78
sp|Q927I5|EFG_LISIN Elongation factor G OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=fusA PE=3 SV=1 1 741 5.0E-78
sp|Q3A6Q0|EFG2_PELCD Elongation factor G 2 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=fusA2 PE=3 SV=1 1 741 6.0E-78
sp|Q8EX19|EFG_MYCPE Elongation factor G OS=Mycoplasma penetrans (strain HF-2) GN=fusA PE=3 SV=1 1 740 6.0E-78
sp|P47335|EFG_MYCGE Elongation factor G OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=fusA PE=3 SV=1 1 738 6.0E-78
sp|Q7WRC7|EFG1_BORBR Elongation factor G 1 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=fusA1 PE=3 SV=1 1 747 6.0E-78
sp|Q8DVV4|EFG_STRMU Elongation factor G OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=fusA PE=3 SV=1 1 741 7.0E-78
sp|Q7W2F8|EFG1_BORPA Elongation factor G 1 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=fusA1 PE=3 SV=1 1 747 7.0E-78
sp|O66428|EFG_AQUAE Elongation factor G OS=Aquifex aeolicus (strain VF5) GN=fusA PE=3 SV=1 1 741 7.0E-78
sp|Q253F1|EFG_CHLFF Elongation factor G OS=Chlamydophila felis (strain Fe/C-56) GN=fusA PE=3 SV=1 1 741 7.0E-78
sp|B2FQ42|EFG_STRMK Elongation factor G OS=Stenotrophomonas maltophilia (strain K279a) GN=fusA PE=3 SV=1 1 739 7.0E-78
sp|A8EW86|EFG_ARCB4 Elongation factor G OS=Arcobacter butzleri (strain RM4018) GN=fusA PE=3 SV=1 1 741 8.0E-78
sp|P9WNM7|EFG_MYCTU Elongation factor G OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fusA PE=1 SV=1 1 741 8.0E-78
sp|P9WNM6|EFG_MYCTO Elongation factor G OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fusA PE=3 SV=1 1 741 8.0E-78
sp|A5U070|EFG_MYCTA Elongation factor G OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=fusA PE=3 SV=1 1 741 8.0E-78
sp|C1AL17|EFG_MYCBT Elongation factor G OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=fusA PE=3 SV=1 1 741 8.0E-78
sp|A1KGG4|EFG_MYCBP Elongation factor G OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=fusA PE=3 SV=1 1 741 8.0E-78
sp|P0A557|EFG_MYCBO Elongation factor G OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fusA PE=3 SV=1 1 741 8.0E-78
sp|B3QZH4|EFG_PHYMT Elongation factor G OS=Phytoplasma mali (strain AT) GN=fusA PE=3 SV=1 1 740 8.0E-78
sp|Q7WFL2|EFG2_BORBR Elongation factor G 2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=fusA2 PE=3 SV=1 1 738 8.0E-78
sp|A8EXK1|EFG_RICCK Elongation factor G OS=Rickettsia canadensis (strain McKiel) GN=fusA PE=3 SV=1 1 741 8.0E-78
sp|C5CP58|EFG_VARPS Elongation factor G OS=Variovorax paradoxus (strain S110) GN=fusA PE=3 SV=1 1 738 8.0E-78
sp|Q03ZQ2|EFG_LEUMM Elongation factor G OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=fusA PE=3 SV=1 1 741 1.0E-77
sp|Q3APH0|EFG_CHLCH Elongation factor G OS=Chlorobium chlorochromatii (strain CaD3) GN=fusA PE=3 SV=1 1 741 1.0E-77
sp|P80868|EFG_BACSU Elongation factor G OS=Bacillus subtilis (strain 168) GN=fusA PE=1 SV=3 1 741 1.0E-77
sp|Q73F99|EFG_BACC1 Elongation factor G OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=fusA PE=3 SV=1 1 741 1.0E-77
sp|Q83JC3|EFG_SHIFL Elongation factor G OS=Shigella flexneri GN=fusA PE=3 SV=3 1 739 1.0E-77
sp|Q0SZX7|EFG_SHIF8 Elongation factor G OS=Shigella flexneri serotype 5b (strain 8401) GN=fusA PE=3 SV=1 1 739 1.0E-77
sp|B9JVN4|EFG_AGRVS Elongation factor G OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=fusA PE=3 SV=1 1 741 1.0E-77
sp|Q31IY5|EFG_THICR Elongation factor G OS=Thiomicrospira crunogena (strain XCL-2) GN=fusA PE=3 SV=1 1 748 1.0E-77
sp|Q6MU82|EFG_MYCMS Elongation factor G OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=fusA PE=3 SV=1 1 738 1.0E-77
sp|Q3YWT2|EFG_SHISS Elongation factor G OS=Shigella sonnei (strain Ss046) GN=fusA PE=3 SV=1 1 739 1.0E-77
sp|Q32B26|EFG_SHIDS Elongation factor G OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fusA PE=3 SV=1 1 739 1.0E-77
sp|Q31VU9|EFG_SHIBS Elongation factor G OS=Shigella boydii serotype 4 (strain Sb227) GN=fusA PE=3 SV=1 1 739 1.0E-77
sp|B2U2U7|EFG_SHIB3 Elongation factor G OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fusA PE=3 SV=1 1 739 1.0E-77
sp|B7LS46|EFG_ESCF3 Elongation factor G OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fusA PE=3 SV=1 1 739 1.0E-77
sp|Q1R5U3|EFG_ECOUT Elongation factor G OS=Escherichia coli (strain UTI89 / UPEC) GN=fusA PE=3 SV=3 1 739 1.0E-77
sp|B1LHE0|EFG_ECOSM Elongation factor G OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fusA PE=3 SV=1 1 739 1.0E-77
sp|B6I240|EFG_ECOSE Elongation factor G OS=Escherichia coli (strain SE11) GN=fusA PE=3 SV=1 1 739 1.0E-77
sp|P0A6M8|EFG_ECOLI Elongation factor G OS=Escherichia coli (strain K12) GN=fusA PE=1 SV=2 1 739 1.0E-77
sp|B1IPV9|EFG_ECOLC Elongation factor G OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fusA PE=3 SV=1 1 739 1.0E-77
sp|P0A6M9|EFG_ECOL6 Elongation factor G OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fusA PE=3 SV=2 1 739 1.0E-77
sp|Q0TCB9|EFG_ECOL5 Elongation factor G OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fusA PE=3 SV=3 1 739 1.0E-77
sp|A1AGM7|EFG_ECOK1 Elongation factor G OS=Escherichia coli O1:K1 / APEC GN=fusA PE=3 SV=1 1 739 1.0E-77
sp|A8A5E7|EFG_ECOHS Elongation factor G OS=Escherichia coli O9:H4 (strain HS) GN=fusA PE=3 SV=1 1 739 1.0E-77
sp|B1X6J0|EFG_ECODH Elongation factor G OS=Escherichia coli (strain K12 / DH10B) GN=fusA PE=3 SV=1 1 739 1.0E-77
sp|C4ZUJ5|EFG_ECOBW Elongation factor G OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fusA PE=3 SV=1 1 739 1.0E-77
sp|B7M1P1|EFG_ECO8A Elongation factor G OS=Escherichia coli O8 (strain IAI1) GN=fusA PE=3 SV=1 1 739 1.0E-77
sp|B7N0X6|EFG_ECO81 Elongation factor G OS=Escherichia coli O81 (strain ED1a) GN=fusA PE=3 SV=1 1 739 1.0E-77
sp|B7NLP5|EFG_ECO7I Elongation factor G OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fusA PE=3 SV=1 1 739 1.0E-77
sp|B5YTP7|EFG_ECO5E Elongation factor G OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fusA PE=3 SV=1 1 739 1.0E-77
sp|P0A6N0|EFG_ECO57 Elongation factor G OS=Escherichia coli O157:H7 GN=fusA PE=3 SV=2 1 739 1.0E-77
sp|B7L4L1|EFG_ECO55 Elongation factor G OS=Escherichia coli (strain 55989 / EAEC) GN=fusA PE=3 SV=1 1 739 1.0E-77
sp|B7MCV5|EFG_ECO45 Elongation factor G OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fusA PE=3 SV=1 1 739 1.0E-77
sp|B7UK50|EFG_ECO27 Elongation factor G OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fusA PE=3 SV=1 1 739 1.0E-77
sp|A7ZSL5|EFG_ECO24 Elongation factor G OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fusA PE=3 SV=1 1 739 1.0E-77
sp|P41084|EFG_RICPR Elongation factor G OS=Rickettsia prowazekii (strain Madrid E) GN=fusA PE=3 SV=3 1 492 1.0E-77
sp|Q7VTD5|EFG_BORPE Elongation factor G OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=fusA PE=3 SV=1 1 747 1.0E-77
sp|A4SHV8|EFG_AERS4 Elongation factor G OS=Aeromonas salmonicida (strain A449) GN=fusA PE=3 SV=2 1 738 2.0E-77
sp|P70782|EFG_RHIRD Elongation factor G OS=Rhizobium radiobacter GN=fusA PE=3 SV=1 1 741 2.0E-77
sp|Q824G0|EFG_CHLCV Elongation factor G OS=Chlamydophila caviae (strain GPIC) GN=fusA PE=3 SV=1 1 741 2.0E-77
sp|Q2N9A7|EFG_ERYLH Elongation factor G OS=Erythrobacter litoralis (strain HTCC2594) GN=fusA PE=3 SV=1 1 741 2.0E-77
sp|B8F7Z4|EFG_HAEPS Elongation factor G OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=fusA PE=3 SV=1 1 734 3.0E-77
sp|A0KQ96|EFG_AERHH Elongation factor G OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=fusA PE=3 SV=1 1 738 3.0E-77
sp|Q2RQV7|EFG_RHORT Elongation factor G OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=fusA PE=3 SV=1 1 741 3.0E-77
sp|Q2S909|EFG1_HAHCH Elongation factor G 1 OS=Hahella chejuensis (strain KCTC 2396) GN=fusA1 PE=3 SV=1 1 738 4.0E-77
sp|Q1LAN7|EFG2_CUPMC Elongation factor G 2 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=fusA2 PE=3 SV=1 1 738 4.0E-77
sp|Q1D513|EFG3_MYXXD Elongation factor G 3 OS=Myxococcus xanthus (strain DK 1622) GN=fusA3 PE=3 SV=1 1 741 4.0E-77
sp|C4LBU4|EFG_TOLAT Elongation factor G OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=fusA PE=3 SV=1 1 738 4.0E-77
sp|B1JIV5|EFG_YERPY Elongation factor G OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=fusA PE=3 SV=1 1 735 5.0E-77
sp|Q664R6|EFG_YERPS Elongation factor G OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fusA PE=3 SV=1 1 735 5.0E-77
sp|A4TGY6|EFG_YERPP Elongation factor G OS=Yersinia pestis (strain Pestoides F) GN=fusA PE=3 SV=1 1 735 5.0E-77
sp|Q1CCT8|EFG_YERPN Elongation factor G OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fusA PE=3 SV=1 1 735 5.0E-77
sp|A9R462|EFG_YERPG Elongation factor G OS=Yersinia pestis bv. Antiqua (strain Angola) GN=fusA PE=3 SV=1 1 735 5.0E-77
sp|Q8ZJB3|EFG_YERPE Elongation factor G OS=Yersinia pestis GN=fusA PE=3 SV=1 1 735 5.0E-77
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0097159 organic cyclic compound binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:1901363 heterocyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0003674 molecular_function No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0016462 pyrophosphatase activity No
GO:0016787 hydrolase activity No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1755
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1410
Ophiocordyceps australis map64 (Brazil) OphauB2|2727
Ophiocordyceps camponoti-floridani Ophcf2|04105
Ophiocordyceps camponoti-rufipedis Ophun1|6159 (this protein)
Ophiocordyceps kimflemingae Ophio5|3979
Ophiocordyceps subramaniannii Hirsu2|165

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6159
MLFYSGVTQRVGNVDAGNTVTDFLELERARGITIQSAAITFHWPLPQNCLPGTQPTTVNLIDTPGHQDFRFEVDR
CLPGLDGAVCIIDSVKGVEAHTERVWASAQEFFIPRIIFCNKMDRDGASFKRAVTEIGTRLRGWPLVCQIPWWEK
SHFVGVIDVINEVGWKWKSEKQKTSYDQEELRELLSTSNRSLLDEIKTARKRLVEGLADYDDVIMDEFLAENTDI
PTPMLKQAIKRAISNGDGRVIPIFLGSSARHIGVEPLMDAIVDYLPNPSERPDVEVQVGSEKHRLGQLLQEAGKK
SNVASVASVFKVSNHPKEGVISFVRIYHGTLTRQSSTYDTNIGKLERPLGILQLSASQTRDVQELTVGQIGAIKG
LRYSRSGDTLLTMTGGKTAVEPIRSIKIRPPEIPPAVAFARISPFGKMAADLLEVALENKSREDPSLRWSRDLTT
DEFTIQGMGKLHLEVSLHDIRQRRDIEAEYGDVDVDYKECVTGPAMTQHVVLDKVINNVAGKVACTITVEAATGR
KEGRGVVEKDGNVFHIEIPRPENGIPYSFAKEEARLQMMNGALAAVARGPRRGSPVHGCRIHMLLDTTPEALHRP
TPHHFSVLGRVAVERVLRDAFKNNQMGLFEPVMLAHFICPEDVAGLVQQDITSGAGGRVLEMADRSSEPGEGDNI
TAARIYTPPDPWDCITSLRDKRVFSRVVEIVAKVPFKEMLDYDSRLRSRTAGRHSLTMQFDSFDRVVGKREKGL*
Coding >Ophun1|6159
ATGCTGTTCTACAGCGGCGTGACGCAAAGAGTTGGCAACGTCGACGCCGGAAACACCGTCACCGACTTCCTCGAG
CTGGAAAGGGCCCGCGGCATCACCATCCAGTCAGCCGCCATCACCTTCCACTGGCCCTTGCCGCAGAACTGTCTC
CCCGGCACTCAGCCCACGACCGTCAACCTCATCGACACGCCGGGCCATCAAGACTTTCGCTTCGAAGTGGACAGA
TGTCTTCCCGGGCTTGACGGCGCCGTCTGCATCATCGACTCGGTCAAGGGCGTCGAGGCTCATACCGAGCGCGTC
TGGGCCTCGGCGCAGGAGTTTTTCATCCCGCGCATCATCTTTTGCAACAAGATGGATCGCGACGGCGCTTCCTTT
AAGCGGGCCGTCACTGAGATTGGTACCCGACTCAGGGGATGGCCGCTCGTCTGTCAGATTCCCTGGTGGGAAAAG
AGCCATTTCGTCGGCGTCATCGACGTCATCAACGAGGTCGGCTGGAAGTGGAAGTCGGAAAAGCAAAAGACTAGC
TATGACCAGGAGGAGCTCAGGGAGCTTCTCTCCACCTCCAATCGCAGCCTGCTGGACGAGATCAAGACGGCCAGG
AAGAGGCTGGTCGAGGGACTCGCCGACTACGACGATGTCATCATGGACGAGTTCTTGGCCGAAAACACCGACATC
CCCACCCCGATGTTGAAGCAGGCCATCAAGAGGGCCATTTCAAATGGCGACGGCCGTGTGATTCCCATCTTCTTG
GGCTCCAGCGCTCGTCACATTGGCGTCGAGCCCTTGATGGACGCCATCGTCGACTACTTACCCAACCCATCCGAG
AGACCCGACGTCGAGGTCCAAGTCGGCTCCGAGAAGCACCGTCTCGGACAGCTGCTCCAAGAGGCCGGCAAAAAG
TCCAACGTCGCCTCGGTGGCATCCGTCTTCAAGGTCTCCAATCACCCCAAGGAGGGAGTCATCAGCTTCGTACGC
ATCTATCACGGCACCCTCACACGTCAGAGCTCCACCTACGACACCAACATCGGCAAGCTGGAGCGACCGCTTGGA
ATCCTGCAGCTCTCGGCCTCGCAGACACGAGACGTACAGGAGCTCACCGTCGGACAGATCGGAGCCATCAAGGGT
CTGAGATACTCGAGGAGCGGAGACACGCTCCTGACCATGACGGGCGGTAAGACGGCCGTCGAGCCCATACGCAGC
ATCAAGATTCGCCCGCCGGAGATACCACCGGCCGTCGCCTTTGCTCGCATCAGCCCGTTTGGGAAGATGGCTGCC
GATCTTCTCGAGGTGGCGCTCGAGAACAAGTCTCGCGAGGATCCCAGCTTGAGATGGAGCCGCGACCTGACGACC
GACGAGTTCACCATCCAGGGCATGGGAAAGCTTCATCTCGAAGTGTCTCTCCACGACATCAGGCAGAGGCGCGAC
ATTGAGGCCGAGTACGGAGACGTCGATGTCGACTACAAGGAGTGCGTCACTGGGCCGGCCATGACGCAGCACGTT
GTCCTGGACAAGGTCATCAACAACGTGGCCGGCAAGGTGGCCTGCACCATCACCGTCGAAGCCGCGACCGGCCGC
AAGGAAGGCCGAGGCGTCGTCGAGAAGGACGGCAACGTCTTTCACATAGAGATCCCGCGGCCCGAAAACGGCATC
CCTTACTCGTTCGCCAAGGAGGAGGCCCGGCTGCAGATGATGAACGGTGCCCTCGCGGCCGTGGCTCGGGGCCCC
CGACGAGGATCTCCCGTCCACGGCTGCCGCATCCACATGCTCCTCGATACGACGCCCGAAGCGCTGCACCGTCCG
ACGCCCCATCACTTCAGCGTCCTCGGCAGAGTAGCCGTCGAAAGGGTCCTCCGCGATGCCTTCAAGAATAACCAG
ATGGGCCTCTTCGAGCCCGTCATGCTCGCCCACTTCATCTGTCCCGAAGACGTGGCCGGCCTGGTCCAGCAAGAC
ATCACCTCCGGCGCCGGCGGCCGGGTGCTCGAGATGGCGGACCGCTCTTCGGAACCGGGCGAGGGCGATAACATC
ACGGCGGCGCGCATCTACACGCCCCCCGATCCGTGGGATTGCATCACGTCGTTGAGGGACAAGAGGGTGTTTAGC
CGCGTCGTCGAGATTGTGGCCAAGGTGCCGTTCAAGGAGATGCTCGACTACGACAGTCGGTTGCGGAGCAGGACG
GCGGGGCGGCACTCGCTGACGATGCAGTTTGACTCGTTTGACAGGGTCGTCGGGAAGAGGGAGAAGGGCTTGTGA
Transcript >Ophun1|6159
ATGCTGTTCTACAGCGGCGTGACGCAAAGAGTTGGCAACGTCGACGCCGGAAACACCGTCACCGACTTCCTCGAG
CTGGAAAGGGCCCGCGGCATCACCATCCAGTCAGCCGCCATCACCTTCCACTGGCCCTTGCCGCAGAACTGTCTC
CCCGGCACTCAGCCCACGACCGTCAACCTCATCGACACGCCGGGCCATCAAGACTTTCGCTTCGAAGTGGACAGA
TGTCTTCCCGGGCTTGACGGCGCCGTCTGCATCATCGACTCGGTCAAGGGCGTCGAGGCTCATACCGAGCGCGTC
TGGGCCTCGGCGCAGGAGTTTTTCATCCCGCGCATCATCTTTTGCAACAAGATGGATCGCGACGGCGCTTCCTTT
AAGCGGGCCGTCACTGAGATTGGTACCCGACTCAGGGGATGGCCGCTCGTCTGTCAGATTCCCTGGTGGGAAAAG
AGCCATTTCGTCGGCGTCATCGACGTCATCAACGAGGTCGGCTGGAAGTGGAAGTCGGAAAAGCAAAAGACTAGC
TATGACCAGGAGGAGCTCAGGGAGCTTCTCTCCACCTCCAATCGCAGCCTGCTGGACGAGATCAAGACGGCCAGG
AAGAGGCTGGTCGAGGGACTCGCCGACTACGACGATGTCATCATGGACGAGTTCTTGGCCGAAAACACCGACATC
CCCACCCCGATGTTGAAGCAGGCCATCAAGAGGGCCATTTCAAATGGCGACGGCCGTGTGATTCCCATCTTCTTG
GGCTCCAGCGCTCGTCACATTGGCGTCGAGCCCTTGATGGACGCCATCGTCGACTACTTACCCAACCCATCCGAG
AGACCCGACGTCGAGGTCCAAGTCGGCTCCGAGAAGCACCGTCTCGGACAGCTGCTCCAAGAGGCCGGCAAAAAG
TCCAACGTCGCCTCGGTGGCATCCGTCTTCAAGGTCTCCAATCACCCCAAGGAGGGAGTCATCAGCTTCGTACGC
ATCTATCACGGCACCCTCACACGTCAGAGCTCCACCTACGACACCAACATCGGCAAGCTGGAGCGACCGCTTGGA
ATCCTGCAGCTCTCGGCCTCGCAGACACGAGACGTACAGGAGCTCACCGTCGGACAGATCGGAGCCATCAAGGGT
CTGAGATACTCGAGGAGCGGAGACACGCTCCTGACCATGACGGGCGGTAAGACGGCCGTCGAGCCCATACGCAGC
ATCAAGATTCGCCCGCCGGAGATACCACCGGCCGTCGCCTTTGCTCGCATCAGCCCGTTTGGGAAGATGGCTGCC
GATCTTCTCGAGGTGGCGCTCGAGAACAAGTCTCGCGAGGATCCCAGCTTGAGATGGAGCCGCGACCTGACGACC
GACGAGTTCACCATCCAGGGCATGGGAAAGCTTCATCTCGAAGTGTCTCTCCACGACATCAGGCAGAGGCGCGAC
ATTGAGGCCGAGTACGGAGACGTCGATGTCGACTACAAGGAGTGCGTCACTGGGCCGGCCATGACGCAGCACGTT
GTCCTGGACAAGGTCATCAACAACGTGGCCGGCAAGGTGGCCTGCACCATCACCGTCGAAGCCGCGACCGGCCGC
AAGGAAGGCCGAGGCGTCGTCGAGAAGGACGGCAACGTCTTTCACATAGAGATCCCGCGGCCCGAAAACGGCATC
CCTTACTCGTTCGCCAAGGAGGAGGCCCGGCTGCAGATGATGAACGGTGCCCTCGCGGCCGTGGCTCGGGGCCCC
CGACGAGGATCTCCCGTCCACGGCTGCCGCATCCACATGCTCCTCGATACGACGCCCGAAGCGCTGCACCGTCCG
ACGCCCCATCACTTCAGCGTCCTCGGCAGAGTAGCCGTCGAAAGGGTCCTCCGCGATGCCTTCAAGAATAACCAG
ATGGGCCTCTTCGAGCCCGTCATGCTCGCCCACTTCATCTGTCCCGAAGACGTGGCCGGCCTGGTCCAGCAAGAC
ATCACCTCCGGCGCCGGCGGCCGGGTGCTCGAGATGGCGGACCGCTCTTCGGAACCGGGCGAGGGCGATAACATC
ACGGCGGCGCGCATCTACACGCCCCCCGATCCGTGGGATTGCATCACGTCGTTGAGGGACAAGAGGGTGTTTAGC
CGCGTCGTCGAGATTGTGGCCAAGGTGCCGTTCAAGGAGATGCTCGACTACGACAGTCGGTTGCGGAGCAGGACG
GCGGGGCGGCACTCGCTGACGATGCAGTTTGACTCGTTTGACAGGGTCGTCGGGAAGAGGGAGAAGGGCTTGTGA
Gene >Ophun1|6159
ATGCTGTTCTACAGCGGCGTGACGCAAAGAGTTGGCAGTCTGTCTCTGTCCCTATAACCCCCATCTTACGCATTT
CCTCACCGTTCCCCCGGACAGACGTCGACGCCGGAAACACCGTCACCGACTTCCTCGAGCTGGAAAGGGCCCGCG
GCATCACCATCCAGTCAGCCGCCATCACCTTCCACTGGCCCTTGCCGCAGAACTGTCTCCCCGGCACTCAGCCCA
CGACCGTCAACCTCATCGACACGCCGGGCCATCAAGACTTTCGCTTCGAAGTGGACAGATGTCTTCCCGGGCTTG
ACGGCGCCGTCTGCATCATCGACTCGGTCAAGGGCGTCGAGGCTCATACCGAGCGCGTCTGGGCCTCGGCGCAGG
AGTTTTTCATCCCGCGCATCATCTTTTGCAACAAGATGGATCGCGACGGCGCTTCCTTTAAGCGGGCCGTCACTG
AGATTGGTACCCGACTCAGGGGATGGCCGCTCGTCTGTCAGATTCCCTGGTGGGAAAAGAGCCATTTCGTCGGCG
TCATCGACGTCATCAACGAGGTCGGCTGGAAGTGGAAGTCGGAAAAGCAAAAGACTAGCTATGACCAGGAGGAGC
TCAGGGAGCTTCTCTCCACCTCCAATCGCAGCCTGCTGGACGAGATCAAGACGGCCAGGAAGAGGCTGGTCGAGG
GACTCGCCGACTACGACGATGTCATCATGGACGAGTTCTTGGCCGAAAACACCGACATCCCCACCCCGATGTTGA
AGCAGGCCATCAAGAGGGCCATTTCAAATGGCGACGGCCGTGTGATTCCCATCTTCTTGGGCTCCAGCGCTCGTC
ACATTGGCGTCGAGCCCTTGATGGACGCCATCGTCGACTACTTACCCAACCCATCCGAGAGACCCGACGTCGAGG
TCCAAGTCGGCTCCGAGAAGCACCGTCTCGGACAGCTGCTCCAAGAGGCCGGCAAAAAGTCCAACGTCGCCTCGG
TGGCATCCGTCTTCAAGGTCTCCAATCACCCCAAGGAGGGAGTCATCAGCTTCGTACGCATCTATCACGGCACCC
TCACACGTCAGAGCTCCACCTACGACACCAACATCGGCAAGCTGGAGCGACCGCTTGGAATCCTGCAGCTCTCGG
CCTCGCAGACACGAGACGTACAGGAGCTCACCGTCGGACAGATCGGAGCCATCAAGGGTCTGAGATACTCGAGGA
GCGGAGACACGCTCCTGACCATGACGGGCGGTAAGACGGCCGTCGAGCCCATACGCAGCATCAAGATTCGCCCGC
CGGAGATACCACCGGCCGTCGCCTTTGCTCGCATCAGCCCGTTTGGGAAGATGGCTGCCGATCTTCTCGAGGTGG
CGCTCGAGAACAAGTCTCGCGAGGATCCCAGCTTGAGATGGAGCCGCGACCTGACGACCGACGAGTTCACCATCC
AGGGCATGGGAAAGCTTCATCTCGAAGTGTCTCTCCACGACATCAGGCAGAGGCGCGACATTGAGGCCGAGTACG
GAGACGTCGATGTCGACTACAAGGAGTGCGTCACTGGGCCGGCCATGACGCAGCACGTTGTCCTGGACAAGGTCA
TCAACAACGTGGCCGGCAAGGTGGCCTGCACCATCACCGTCGAAGCCGCGACCGGCCGCAAGGAAGGCCGAGGCG
TCGTCGAGAAGGACGGCAACGTCTTTCACATAGAGATCCCGCGGCCCGAAAACGGCATCCCTTACTCGTTCGCCA
AGGAGGAGGCCCGGCTGCAGATGATGAACGGTGCCCTCGCGGCCGTGGCTCGGGGCCCCCGACGAGGATCTCCCG
TCCACGGCTGCCGCATCCACATGCTCCTCGATACGACGCCCGAAGCGCTGCACCGTCCGACGCCCCATCACTTCA
GCGTCCTCGGCAGAGTAGCCGTCGAAAGGGTCCTCCGCGATGCCTTCAAGAATAACCAGATGGGCCTCTTCGAGC
CCGTCATGCTCGCCCACTTCATCTGTCCCGAAGACGTGGCCGGCCTGGTCCAGCAAGACATCACCTCCGGCGCCG
GCGGCCGGGTGCTCGAGATGGCGGACCGCTCTTCGGAACCGGGCGAGGGCGATAACATCACGGCGGCGCGCATCT
ACACGCCCCCCGATCCGTGGGATTGCATCACGTCGTTGAGGGACAAGAGGGTGTTTAGCCGCGTCGTCGAGATTG
TGGCCAAGGTGCCGTTCAAGGAGATGCTCGACTACGACAGTCGGTTGCGGAGCAGGACGGCGGGGCGGCACTCGC
TGACGATGCAGTTTGACTCGTTTGACAGGGTCGTCGGGAAGAGGGAGAAGGGCTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail