Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6157
Gene name
LocationContig_652:4189..5717
Strand-
Gene length (bp)1528
Transcript length (bp)1344
Coding sequence length (bp)1344
Protein length (aa) 448

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12767 SAGA-Tad1 Transcriptional regulator of RNA polII, SAGA, subunit 4.0E-58 44 279

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12060|HFI1_YEAST Transcriptional coactivator HFI1/ADA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFI1 PE=1 SV=1 46 273 1.0E-11
sp|O94301|HFI1_SCHPO Transcriptional coactivator hfi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hfi1 PE=3 SV=1 49 283 8.0E-10

GO

GO Term Description Terminal node
GO:0070461 SAGA-type complex Yes
GO:1990234 transferase complex No
GO:0000123 histone acetyltransferase complex No
GO:0031248 protein acetyltransferase complex No
GO:1902494 catalytic complex No
GO:0005575 cellular_component No
GO:0140513 nuclear protein-containing complex No
GO:1902493 acetyltransferase complex No
GO:0140535 intracellular protein-containing complex No
GO:0032991 protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6157
MPDIDPAALSRPVVTLSTPILSHKTLSISSAGTIRPVKASQIIPARIDLEPVYGPLKAAIGAEQWLIYKETTAEF
LTGRLSQAEFSDRMDPLLGGDNGEKDHLHNLLVAALLGNVTREMPDQGIAPWVSANDKPVAPVASKPVTGDAAER
RLKGDVMQLPARDRRRIKDLAQMDFDPHDALANAFIDSHRKPTSIPEPSSSAVGSINKMNFDLEIRKRFAQPLAV
ESGEFPDVGLVTARMLPMCYEAGLVGGHAADAPQLMGVATETFIKEILTQLFSRTRSNGPGDSGSAGPGIGTTWI
QTRKYQRQLRIEEEAAQRGELSRDKNGLLPVEAKAAADRPQLGMADLRLSLELADSGMAQFPALRTQVLLGYRDG
ELENWDDYTYIGGKRPEPVDSGGMARQEQSGALNGHAEAMDIDAGDGWWEGAERQDVDMLDGILDSCLAVGS*
Coding >Ophun1|6157
ATGCCCGACATCGATCCAGCGGCCTTGAGCCGCCCTGTCGTCACCCTGTCGACACCCATCCTCTCCCACAAGACG
CTCTCCATCAGCTCGGCCGGAACTATCAGGCCGGTCAAGGCGAGCCAGATAATACCCGCCCGTATCGACCTCGAG
CCTGTCTACGGGCCCCTCAAAGCAGCCATCGGCGCCGAGCAATGGCTGATATACAAGGAGACCACGGCAGAATTT
CTTACCGGGCGTCTGAGCCAGGCTGAATTCTCGGACCGCATGGATCCGCTCCTCGGCGGCGATAATGGCGAAAAA
GACCATCTCCATAATCTTCTCGTCGCTGCCCTGCTGGGAAACGTGACGCGAGAAATGCCCGATCAAGGGATCGCG
CCCTGGGTCAGCGCAAATGATAAGCCCGTGGCACCCGTGGCAAGCAAACCCGTTACCGGTGACGCGGCAGAGCGC
AGGCTCAAGGGTGACGTGATGCAATTGCCGGCCAGGGATCGGAGGCGCATAAAGGATCTGGCACAGATGGACTTT
GATCCCCATGACGCGCTGGCAAACGCATTCATAGACTCGCACCGGAAGCCGACCAGCATTCCGGAGCCCTCGTCG
AGTGCAGTTGGCAGCATCAATAAGATGAATTTTGACCTGGAGATACGGAAGCGATTCGCCCAGCCGCTGGCTGTC
GAGTCTGGGGAGTTTCCGGACGTCGGGCTCGTCACAGCTCGGATGCTACCCATGTGCTACGAGGCTGGGCTGGTG
GGCGGTCATGCCGCCGACGCGCCGCAGCTCATGGGTGTCGCGACGGAGACGTTTATCAAGGAGATATTGACGCAA
CTTTTCAGCCGTACGCGGAGCAATGGACCGGGAGACTCGGGGAGCGCGGGCCCGGGAATCGGCACGACCTGGATC
CAGACGCGCAAGTATCAACGACAGCTCCGGATAGAGGAGGAGGCGGCGCAGCGGGGCGAGTTGTCGCGAGACAAA
AATGGGCTACTTCCCGTCGAGGCCAAGGCGGCCGCGGATCGGCCACAGCTGGGCATGGCCGACCTGCGGCTATCG
CTCGAGCTGGCGGACTCGGGCATGGCGCAGTTTCCTGCCCTCCGGACGCAGGTGTTGCTCGGATACCGCGACGGC
GAACTGGAGAACTGGGACGACTACACGTACATTGGCGGCAAACGACCCGAACCCGTCGATTCTGGTGGCATGGCA
AGACAGGAGCAATCAGGAGCGCTTAACGGGCACGCCGAAGCCATGGACATTGACGCCGGCGACGGTTGGTGGGAA
GGGGCGGAGAGGCAAGACGTGGACATGCTGGACGGCATCCTGGACTCATGCCTGGCGGTAGGGTCCTAG
Transcript >Ophun1|6157
ATGCCCGACATCGATCCAGCGGCCTTGAGCCGCCCTGTCGTCACCCTGTCGACACCCATCCTCTCCCACAAGACG
CTCTCCATCAGCTCGGCCGGAACTATCAGGCCGGTCAAGGCGAGCCAGATAATACCCGCCCGTATCGACCTCGAG
CCTGTCTACGGGCCCCTCAAAGCAGCCATCGGCGCCGAGCAATGGCTGATATACAAGGAGACCACGGCAGAATTT
CTTACCGGGCGTCTGAGCCAGGCTGAATTCTCGGACCGCATGGATCCGCTCCTCGGCGGCGATAATGGCGAAAAA
GACCATCTCCATAATCTTCTCGTCGCTGCCCTGCTGGGAAACGTGACGCGAGAAATGCCCGATCAAGGGATCGCG
CCCTGGGTCAGCGCAAATGATAAGCCCGTGGCACCCGTGGCAAGCAAACCCGTTACCGGTGACGCGGCAGAGCGC
AGGCTCAAGGGTGACGTGATGCAATTGCCGGCCAGGGATCGGAGGCGCATAAAGGATCTGGCACAGATGGACTTT
GATCCCCATGACGCGCTGGCAAACGCATTCATAGACTCGCACCGGAAGCCGACCAGCATTCCGGAGCCCTCGTCG
AGTGCAGTTGGCAGCATCAATAAGATGAATTTTGACCTGGAGATACGGAAGCGATTCGCCCAGCCGCTGGCTGTC
GAGTCTGGGGAGTTTCCGGACGTCGGGCTCGTCACAGCTCGGATGCTACCCATGTGCTACGAGGCTGGGCTGGTG
GGCGGTCATGCCGCCGACGCGCCGCAGCTCATGGGTGTCGCGACGGAGACGTTTATCAAGGAGATATTGACGCAA
CTTTTCAGCCGTACGCGGAGCAATGGACCGGGAGACTCGGGGAGCGCGGGCCCGGGAATCGGCACGACCTGGATC
CAGACGCGCAAGTATCAACGACAGCTCCGGATAGAGGAGGAGGCGGCGCAGCGGGGCGAGTTGTCGCGAGACAAA
AATGGGCTACTTCCCGTCGAGGCCAAGGCGGCCGCGGATCGGCCACAGCTGGGCATGGCCGACCTGCGGCTATCG
CTCGAGCTGGCGGACTCGGGCATGGCGCAGTTTCCTGCCCTCCGGACGCAGGTGTTGCTCGGATACCGCGACGGC
GAACTGGAGAACTGGGACGACTACACGTACATTGGCGGCAAACGACCCGAACCCGTCGATTCTGGTGGCATGGCA
AGACAGGAGCAATCAGGAGCGCTTAACGGGCACGCCGAAGCCATGGACATTGACGCCGGCGACGGTTGGTGGGAA
GGGGCGGAGAGGCAAGACGTGGACATGCTGGACGGCATCCTGGACTCATGCCTGGCGGTAGGGTCCTAG
Gene >Ophun1|6157
ATGCCCGACATCGATCCAGCGGCCTTGAGCCGCCCTGTCGTCACCCTGTCGACACCCATCCTCTCCCACAAGACG
CTCTCCATCAGCTCGGCCGGAACTATCAGGCCGGTCAAGGCGAGCCAGATAATACCCGCCCGTATCGACCTCGAG
CCTGTCTACGGGCCCCTCAAAGCAGCCATCGGCGCCGAGCAATGGCTGATATACAAGGAGACCACGGCAGAATTT
CTTACCGGTAGGCTCCTCGTGTGTCTCTTCTGGGTAATGCGATGGCTGACGGTGGTACGTTGCGCCAGGGCGTCT
GAGCCAGGCTGAATTCTCGGACCGCATGGATCCGCTCCTCGGCGGCGATAATGGCGAAAAAGACCATCTCCATAA
TCTTCTCGTCGCTGCCCTGCTGGGAAACGTGACGCGAGAAATGCCCGATCAAGGGATCGCGCCCTGGGTCAGCGC
AAATGATAAGCCCGTGGCACCCGTGGCAAGCAAACCCGTTACCGGTGACGCGGCAGAGCGCAGGCTCAAGGGTGA
CGTGATGCAATTGCCGGCCAGGGATCGGAGGCGCATAAAGGATCTGGCACAGATGGACGTAAGTCGTCTTCCTAC
TGACAGACGTGCAAAGCTTCCGCCCCATGCTGACCAGTCTTGCCAGTTTGATCCCCATGACGCGCTGGCAAACGC
ATTCATAGACTCGCACCGGAAGCCGACCAGCATTCCGGAGCCCTCGTCGAGTGCAGTTGGCAGCATCAATAAGAT
GAGTGCGTCCCACGAAGGAAAACCCCCCTTTGTTCTGAAGCATGGCTGACGGAGCATGTCAGATTTTGACCTGGA
GATACGGAAGCGATTCGCCCAGCCGCTGGCTGTCGAGTCTGGGGAGTTTCCGGACGTCGGGCTCGTCACAGCTCG
GATGCTACCCATGTGCTACGAGGCTGGGCTGGTGGGCGGTCATGCCGCCGACGCGCCGCAGCTCATGGGTGTCGC
GACGGAGACGTTTATCAAGGAGATATTGACGCAACTTTTCAGCCGTACGCGGAGCAATGGACCGGGAGACTCGGG
GAGCGCGGGCCCGGGAATCGGCACGACCTGGATCCAGACGCGCAAGTATCAACGACAGCTCCGGATAGAGGAGGA
GGCGGCGCAGCGGGGCGAGTTGTCGCGAGACAAAAATGGGCTACTTCCCGTCGAGGCCAAGGCGGCCGCGGATCG
GCCACAGCTGGGCATGGCCGACCTGCGGCTATCGCTCGAGCTGGCGGACTCGGGCATGGCGCAGTTTCCTGCCCT
CCGGACGCAGGTGTTGCTCGGATACCGCGACGGCGAACTGGAGAACTGGGACGACTACACGTACATTGGCGGCAA
ACGACCCGAACCCGTCGATTCTGGTGGCATGGCAAGACAGGAGCAATCAGGAGCGCTTAACGGGCACGCCGAAGC
CATGGACATTGACGCCGGCGACGGTTGGTGGGAAGGGGCGGAGAGGCAAGACGTGGACATGCTGGACGGCATCCT
GGACTCATGCCTGGCGGTAGGGTCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail