Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6152
Gene name
LocationContig_651:31..3518
Strand-
Gene length (bp)3487
Transcript length (bp)2721
Coding sequence length (bp)2721
Protein length (aa) 907

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00326 Peptidase_S9 Prolyl oligopeptidase family 1.5E-56 459 668

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0XRV0|DPP5_ASPFC Dipeptidyl-peptidase 5 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_024920 PE=1 SV=1 3 684 8.0E-175
sp|P0C959|DPP5_ASPFU Dipeptidyl-peptidase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G09030 PE=2 SV=1 3 684 9.0E-175
sp|A1CSW4|DPP5_ASPCL Probable dipeptidyl-peptidase 5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dpp5 PE=3 SV=1 3 684 9.0E-172
sp|C5FH88|DPP5_ARTOC Dipeptidyl-peptidase 5 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=DPP5 PE=3 SV=1 3 685 1.0E-168
sp|D4ARB1|DPP5_ARTBC Probable dipeptidyl-peptidase 5 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=DPP5 PE=1 SV=1 3 675 2.0E-167
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0XRV0|DPP5_ASPFC Dipeptidyl-peptidase 5 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_024920 PE=1 SV=1 3 684 8.0E-175
sp|P0C959|DPP5_ASPFU Dipeptidyl-peptidase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G09030 PE=2 SV=1 3 684 9.0E-175
sp|A1CSW4|DPP5_ASPCL Probable dipeptidyl-peptidase 5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dpp5 PE=3 SV=1 3 684 9.0E-172
sp|C5FH88|DPP5_ARTOC Dipeptidyl-peptidase 5 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=DPP5 PE=3 SV=1 3 685 1.0E-168
sp|D4ARB1|DPP5_ARTBC Probable dipeptidyl-peptidase 5 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=DPP5 PE=1 SV=1 3 675 2.0E-167
sp|A0S5W0|DPP5_ARTOT Dipeptidyl-peptidase 5 OS=Arthroderma otae GN=DPP5 PE=3 SV=1 3 685 7.0E-167
sp|D4D5P5|DPP5_TRIVH Probable dipeptidyl-peptidase 5 OS=Trichophyton verrucosum (strain HKI 0517) GN=DPP5 PE=3 SV=1 3 675 2.0E-166
sp|Q8J1M3|DPP5_ARTBE Dipeptidyl-peptidase 5 OS=Arthroderma benhamiae GN=DPPV PE=1 SV=1 3 675 3.0E-166
sp|Q8J1L4|DPP5_TRISH Dipeptidyl-peptidase 5 OS=Trichophyton schoenleinii GN=DPPV PE=1 SV=1 3 675 1.0E-165
sp|Q9UW98|DPP5_TRIRU Dipeptidyl-peptidase 5 OS=Trichophyton rubrum GN=DPPV PE=1 SV=1 3 675 3.0E-165
sp|B6V869|DPP5_TRITO Dipeptidyl-peptidase 5 OS=Trichophyton tonsurans GN=DPP5 PE=3 SV=1 3 675 1.0E-164
sp|A7UKV4|DPP5_TRIEQ Dipeptidyl-peptidase 5 OS=Trichophyton equinum GN=DPP5 PE=3 SV=1 3 675 2.0E-164
sp|B8NBM3|DPP5_ASPFN Probable dipeptidyl-peptidase 5 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=dpp5 PE=3 SV=2 3 684 1.0E-163
sp|Q9Y8E3|DPP5_ASPOR Dipeptidyl-peptidase 5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090011000795-A PE=3 SV=2 3 684 5.0E-163
sp|Q0C8V9|DPP5_ASPTN Probable dipeptidyl-peptidase 5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dpp5 PE=3 SV=1 3 684 8.0E-161
sp|Q5BA58|DPP5_EMENI Probable dipeptidyl-peptidase 5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dpp5 PE=1 SV=1 3 671 3.0E-155
sp|Q9P778|DPP5_SCHPO Dipeptidyl-peptidase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1711.12 PE=3 SV=1 2 667 6.0E-153
sp|A2QZF1|DPP5_ASPNC Probable dipeptidyl-peptidase 5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dpp5 PE=3 SV=1 3 669 9.0E-135
sp|Q3LS63|DPP5_ASPNG Probable dipeptidyl-peptidase 5 OS=Aspergillus niger GN=dpp5 PE=3 SV=1 3 669 1.0E-133
sp|Q95WU5|DPP_GIAIN Dipeptidyl-peptidase 4 OS=Giardia intestinalis GN=DPP PE=1 SV=1 111 666 2.0E-59
sp|P39839|YUXL_BACSU Uncharacterized peptidase YuxL OS=Bacillus subtilis (strain 168) GN=yuxL PE=3 SV=3 422 648 3.0E-28
sp|P13676|ACPH_RAT Acylamino-acid-releasing enzyme OS=Rattus norvegicus GN=Apeh PE=1 SV=1 427 661 4.0E-23
sp|Q8R146|APEH_MOUSE Acylamino-acid-releasing enzyme OS=Mus musculus GN=Apeh PE=1 SV=3 427 661 2.0E-22
sp|P19205|ACPH_PIG Acylamino-acid-releasing enzyme OS=Sus scrofa GN=APEH PE=1 SV=2 426 661 2.0E-21
sp|P13798|ACPH_HUMAN Acylamino-acid-releasing enzyme OS=Homo sapiens GN=APEH PE=1 SV=4 427 661 1.0E-20
sp|P80227|ACPH_BOVIN Acylamino-acid-releasing enzyme OS=Bos taurus GN=APEH PE=1 SV=2 426 661 1.0E-20
sp|V5YMB3|DAPB3_PSEMX Dipeptidyl aminopeptidase BIII OS=Pseudoxanthomonas mexicana GN=dapb3 PE=1 SV=1 442 668 2.0E-14
sp|Q9YBQ2|APEH_AERPE Acylamino-acid-releasing enzyme OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=APE_1547.1 PE=1 SV=1 442 653 2.0E-12
sp|Q80YA7|DPP8_MOUSE Dipeptidyl peptidase 8 OS=Mus musculus GN=Dpp8 PE=1 SV=1 426 668 2.0E-11
sp|Q6V1X1|DPP8_HUMAN Dipeptidyl peptidase 8 OS=Homo sapiens GN=DPP8 PE=1 SV=1 426 668 4.0E-11
sp|Q6F3I7|DAP4_PSEMX Dipeptidyl aminopeptidase 4 OS=Pseudoxanthomonas mexicana GN=dap4 PE=1 SV=1 417 644 5.0E-11
sp|B6HFS8|DAPB_PENRW Probable dipeptidyl-aminopeptidase B OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=dapB PE=3 SV=1 426 680 7.0E-10
sp|Q86TI2|DPP9_HUMAN Dipeptidyl peptidase 9 OS=Homo sapiens GN=DPP9 PE=1 SV=3 426 666 3.0E-09
sp|Q7SHU8|DAPB_NEUCR Probable dipeptidyl-aminopeptidase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dapB PE=3 SV=2 417 683 6.0E-09
sp|P46101|DPP6_RAT Dipeptidyl aminopeptidase-like protein 6 OS=Rattus norvegicus GN=Dpp6 PE=1 SV=1 429 663 7.0E-09
sp|P42658|DPP6_HUMAN Dipeptidyl aminopeptidase-like protein 6 OS=Homo sapiens GN=DPP6 PE=1 SV=2 429 663 1.0E-08
sp|Q5IS50|DPP6_PANTR Dipeptidyl aminopeptidase-like protein 6 OS=Pan troglodytes GN=DPP6 PE=2 SV=1 429 663 2.0E-08
sp|D1Z9B4|DAPB_SORMK Probable dipeptidyl-aminopeptidase B OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=DAPB PE=3 SV=1 431 688 3.0E-08
sp|B2A951|DAPB_PODAN Probable dipeptidyl-aminopeptidase B OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=DAPB PE=3 SV=1 421 686 5.0E-08
sp|E4UYL6|DAPB_ARTGP Probable dipeptidyl-aminopeptidase B OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=DAPB PE=3 SV=1 431 668 5.0E-08
sp|Q8BVG4|DPP9_MOUSE Dipeptidyl peptidase 9 OS=Mus musculus GN=Dpp9 PE=1 SV=2 426 666 5.0E-08
sp|C1GT79|DAPB_PARBA Probable dipeptidyl-aminopeptidase B OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=DAPB PE=3 SV=1 431 680 9.0E-08
sp|C0S7H1|DAPB_PARBP Probable dipeptidyl-aminopeptidase B OS=Paracoccidioides brasiliensis (strain Pb03) GN=DAPB PE=3 SV=2 431 687 5.0E-07
sp|D4DCG0|DAPB_TRIVH Probable dipeptidyl-aminopeptidase B OS=Trichophyton verrucosum (strain HKI 0517) GN=DAPB PE=3 SV=1 431 646 6.0E-07
sp|D4AQT0|DAPB_ARTBC Probable dipeptidyl-aminopeptidase B OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=DAPB PE=3 SV=1 431 646 9.0E-07
sp|F0XS04|DAPB_GROCL Probable dipeptidyl-aminopeptidase B OS=Grosmannia clavigera (strain kw1407 / UAMH 11150) GN=DAPB PE=3 SV=1 419 668 9.0E-07
sp|C0NUQ8|DAPB_AJECG Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=DAPB PE=3 SV=1 431 550 1.0E-06
sp|C1FZL3|DAPB_PARBD Probable dipeptidyl-aminopeptidase B OS=Paracoccidioides brasiliensis (strain Pb18) GN=DAPB PE=3 SV=1 431 687 2.0E-06
sp|Q9P6P0|TAF3_SCHPO Transcription initiation factor TFIID subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf3 PE=3 SV=1 705 840 2.0E-06
sp|A6RBI0|DAPB_AJECN Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DAPB PE=3 SV=1 431 550 2.0E-06
sp|C5JC30|DAPB_AJEDS Probable dipeptidyl-aminopeptidase B OS=Ajellomyces dermatitidis (strain SLH14081) GN=DAPB PE=3 SV=1 431 550 2.0E-06
sp|C5GVF3|DAPB_AJEDR Probable dipeptidyl-aminopeptidase B OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=DAPB PE=3 SV=1 431 550 2.0E-06
sp|C6HRC7|DAPB_AJECH Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain H143) GN=DAPB PE=3 SV=1 431 550 4.0E-06
sp|F0U7H7|DAPB_AJEC8 Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain H88) GN=DAPB PE=3 SV=1 431 550 4.0E-06
sp|D5GM60|DAPB_TUBMM Probable dipeptidyl-aminopeptidase B OS=Tuber melanosporum (strain Mel28) GN=DAPB PE=3 SV=1 417 549 6.0E-06
sp|P33894|STE13_YEAST Dipeptidyl aminopeptidase A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE13 PE=1 SV=1 421 663 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0008236 serine-type peptidase activity Yes
GO:0019538 protein metabolic process No
GO:0008233 peptidase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0017171 serine hydrolase activity No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6152
MSYSFETHSRSSSIRVLDINNASSHLIADDAEASDPVWIGDEEVLYFKAGGNSETLMYARQVGSQSEPQLVHKLK
GSVFAPKTKQLSDGKVAICCAAVTTPAGQMLWQPRETKPHSSAKVYSSLFVRHWDAWETKNSNSIWYGQLSKQDG
KWKLDGPGLTNLLAGTCLVSPVPNFGGANDYDIADNAICFVAKDPNLNPARYTKSDLYYAPIYSFADGSAGPIEM
VDDPKSPYEDFLDGRIITRTQKLRGYAGHPTFSRDGKKIAYTKMKSDQYESDKTRLLIVPDVDDLSKVQELHASR
FGHGSWDRSPDSISWSHDDKELFVTAEQYGRAVLWRLPSYPDENREPERVFRPEGSVTAAKPLGKGPLLLITTRS
LVESSNYATFDYGTGTMTQLSSITKNGRSLGLSRSQVDELWTPGSDATENHALVVKPSNFDKSKKYPLALLIHGG
PQGAWTDDWSTRWNPAVFAEQGYVVVCPNPTGSTGYGQEHVDAIRGNWGGTPYKDLVMCFEYLEREVEYIDTDRA
VALGGSYGGYMINWIQGHELGRKFKALVCHDGVFSTQNQWSTEELFFPEHDFCGTLWDNRKMYAKWDPSLHLDKW
STPQLVIHSELDYRLPISEGLAMFNVLQARGVPSKLLVFPDENHWVTKPENSLVWHREVLGWINKYSGVEKTTAR
RAPSDDRRIRPAPQRRQQRNHSTMAGQAALYHALLRPSMLQILRATGYHATKGAVLDSVTDLAARYLYALCEATA
AHAAHNHGSGDFTAADMGFALRDVGALLPEGRSGEDVRGVDDFLRWFAGGRMREIAEMGREGEADATDYLAALKK
KHSKTGDDNKYHGTLIGRFADTACEIQVEGGTESSIDEWVMHRSSLFFDPPTPPLRPAPAPTRLPLPPPARDDDE
DDVARF*
Coding >Ophun1|6152
ATGTCGTACTCTTTTGAGACGCATTCGAGGTCGTCGTCCATCCGAGTTCTGGACATCAACAACGCCTCATCCCAT
CTCATTGCGGACGACGCCGAGGCTAGCGACCCGGTCTGGATCGGCGACGAGGAGGTGCTTTACTTCAAAGCAGGC
GGCAATTCGGAGACGTTGATGTATGCTCGCCAAGTCGGGAGTCAATCCGAACCGCAACTGGTTCACAAGCTCAAA
GGCAGCGTCTTCGCCCCCAAGACCAAGCAGTTGTCGGACGGAAAGGTTGCCATCTGCTGTGCTGCAGTGACGACG
CCCGCCGGTCAAATGCTTTGGCAGCCTCGCGAGACCAAGCCTCACTCGTCCGCCAAGGTTTACTCATCGCTCTTC
GTTCGCCACTGGGATGCCTGGGAGACGAAGAATTCAAACTCCATTTGGTACGGTCAGCTCTCCAAACAGGATGGC
AAGTGGAAGCTCGACGGGCCCGGCCTCACCAACCTGCTCGCGGGTACCTGTCTCGTCTCGCCCGTTCCCAACTTT
GGCGGCGCCAATGACTACGACATTGCCGACAATGCAATCTGCTTCGTAGCCAAGGATCCAAACCTCAATCCCGCC
CGGTACACCAAGTCAGATCTCTACTATGCGCCCATCTATTCCTTCGCCGATGGCTCCGCGGGTCCTATCGAGATG
GTCGACGATCCTAAATCGCCCTATGAAGACTTTTTAGATGGCAGAATAATCACAAGGACTCAGAAGCTTCGCGGT
TACGCGGGCCACCCGACCTTTTCCAGGGATGGCAAAAAGATTGCTTATACGAAAATGAAGAGCGACCAGTACGAA
TCAGACAAGACGCGGCTTCTGATCGTGCCCGACGTCGATGACTTGAGCAAGGTGCAAGAACTTCACGCGTCGAGA
TTTGGCCATGGCTCCTGGGACCGCAGCCCGGACTCCATCAGCTGGAGCCACGACGACAAGGAGCTCTTCGTGACG
GCCGAACAGTACGGCAGGGCTGTTCTCTGGAGACTCCCGTCTTATCCCGACGAGAACCGTGAGCCGGAGCGTGTG
TTTCGCCCGGAGGGTTCCGTCACGGCCGCCAAACCCCTCGGCAAAGGCCCTTTGCTGCTCATTACGACTCGATCC
CTGGTGGAGAGCTCCAACTACGCAACGTTCGATTACGGCACTGGGACCATGACTCAACTCTCGTCCATCACTAAG
AATGGTAGGTCGTTGGGCTTGAGCAGGTCGCAAGTGGATGAGCTTTGGACTCCCGGAAGCGACGCGACAGAGAAT
CACGCGCTGGTGGTCAAGCCTTCCAACTTTGACAAGTCCAAAAAGTACCCCTTGGCTTTGTTAATCCACGGCGGG
CCGCAGGGGGCTTGGACGGACGACTGGAGCACGCGCTGGAACCCGGCCGTCTTTGCCGAGCAGGGCTACGTGGTG
GTGTGTCCCAACCCGACGGGCAGCACGGGCTACGGTCAGGAGCACGTCGACGCCATCCGAGGCAACTGGGGTGGC
ACACCTTACAAAGACCTCGTCATGTGCTTCGAGTATCTGGAGAGGGAGGTCGAGTACATTGACACGGATCGTGCC
GTGGCTCTTGGGGGCTCGTACGGCGGTTACATGATCAACTGGATCCAGGGCCATGAGCTGGGACGAAAGTTCAAG
GCGCTGGTTTGTCACGACGGCGTCTTCTCCACGCAAAACCAGTGGTCGACGGAGGAGCTATTCTTCCCCGAGCAT
GACTTTTGCGGAACGCTCTGGGACAACCGCAAGATGTACGCCAAGTGGGATCCGTCGCTGCACCTGGACAAGTGG
TCGACGCCGCAGCTGGTGATTCACAGCGAGCTCGACTACCGCCTGCCCATCTCGGAGGGTCTGGCCATGTTTAAT
GTGTTGCAGGCGCGCGGTGTGCCCAGCAAGCTTCTTGTTTTTCCGGACGAGAATCATTGGGTTACGAAGCCGGAG
AACTCGCTGGTCTGGCACCGGGAAGTGCTGGGCTGGATCAACAAGTATAGCGGCGTGGAAAAGACGACCGCGAGA
CGCGCCCCATCCGATGATAGGCGCATCCGCCCAGCACCTCAGCGGCGGCAGCAGCGCAACCATTCCACCATGGCA
GGCCAAGCAGCCCTCTATCACGCGCTGCTACGTCCCTCAATGCTGCAGATCCTCCGAGCGACGGGATACCACGCG
ACCAAGGGCGCCGTCCTAGACTCTGTGACGGATCTGGCAGCCCGCTACCTGTACGCTCTCTGCGAGGCGACGGCC
GCCCACGCCGCTCACAACCACGGCTCGGGCGATTTCACCGCTGCCGACATGGGGTTCGCCCTGCGCGATGTCGGC
GCTCTGCTTCCTGAGGGGAGGTCTGGCGAGGATGTGAGGGGGGTGGATGACTTTCTGAGATGGTTTGCGGGGGGG
AGGATGAGGGAGATTGCGGAGATGGGGAGGGAGGGTGAGGCTGATGCGACGGATTATCTTGCTGCGCTCAAGAAG
AAGCATAGCAAGACGGGCGACGATAACAAGTACCACGGCACCCTCATCGGCAGATTCGCAGACACAGCCTGCGAG
ATCCAAGTCGAAGGCGGGACCGAGTCCTCCATCGACGAATGGGTCATGCACAGAAGCAGCCTGTTCTTCGACCCG
CCCACCCCGCCCCTCCGTCCGGCACCGGCACCGACGCGACTTCCGCTGCCTCCACCGGCGCGGGACGATGATGAG
GATGATGTGGCGCGGTTCTGA
Transcript >Ophun1|6152
ATGTCGTACTCTTTTGAGACGCATTCGAGGTCGTCGTCCATCCGAGTTCTGGACATCAACAACGCCTCATCCCAT
CTCATTGCGGACGACGCCGAGGCTAGCGACCCGGTCTGGATCGGCGACGAGGAGGTGCTTTACTTCAAAGCAGGC
GGCAATTCGGAGACGTTGATGTATGCTCGCCAAGTCGGGAGTCAATCCGAACCGCAACTGGTTCACAAGCTCAAA
GGCAGCGTCTTCGCCCCCAAGACCAAGCAGTTGTCGGACGGAAAGGTTGCCATCTGCTGTGCTGCAGTGACGACG
CCCGCCGGTCAAATGCTTTGGCAGCCTCGCGAGACCAAGCCTCACTCGTCCGCCAAGGTTTACTCATCGCTCTTC
GTTCGCCACTGGGATGCCTGGGAGACGAAGAATTCAAACTCCATTTGGTACGGTCAGCTCTCCAAACAGGATGGC
AAGTGGAAGCTCGACGGGCCCGGCCTCACCAACCTGCTCGCGGGTACCTGTCTCGTCTCGCCCGTTCCCAACTTT
GGCGGCGCCAATGACTACGACATTGCCGACAATGCAATCTGCTTCGTAGCCAAGGATCCAAACCTCAATCCCGCC
CGGTACACCAAGTCAGATCTCTACTATGCGCCCATCTATTCCTTCGCCGATGGCTCCGCGGGTCCTATCGAGATG
GTCGACGATCCTAAATCGCCCTATGAAGACTTTTTAGATGGCAGAATAATCACAAGGACTCAGAAGCTTCGCGGT
TACGCGGGCCACCCGACCTTTTCCAGGGATGGCAAAAAGATTGCTTATACGAAAATGAAGAGCGACCAGTACGAA
TCAGACAAGACGCGGCTTCTGATCGTGCCCGACGTCGATGACTTGAGCAAGGTGCAAGAACTTCACGCGTCGAGA
TTTGGCCATGGCTCCTGGGACCGCAGCCCGGACTCCATCAGCTGGAGCCACGACGACAAGGAGCTCTTCGTGACG
GCCGAACAGTACGGCAGGGCTGTTCTCTGGAGACTCCCGTCTTATCCCGACGAGAACCGTGAGCCGGAGCGTGTG
TTTCGCCCGGAGGGTTCCGTCACGGCCGCCAAACCCCTCGGCAAAGGCCCTTTGCTGCTCATTACGACTCGATCC
CTGGTGGAGAGCTCCAACTACGCAACGTTCGATTACGGCACTGGGACCATGACTCAACTCTCGTCCATCACTAAG
AATGGTAGGTCGTTGGGCTTGAGCAGGTCGCAAGTGGATGAGCTTTGGACTCCCGGAAGCGACGCGACAGAGAAT
CACGCGCTGGTGGTCAAGCCTTCCAACTTTGACAAGTCCAAAAAGTACCCCTTGGCTTTGTTAATCCACGGCGGG
CCGCAGGGGGCTTGGACGGACGACTGGAGCACGCGCTGGAACCCGGCCGTCTTTGCCGAGCAGGGCTACGTGGTG
GTGTGTCCCAACCCGACGGGCAGCACGGGCTACGGTCAGGAGCACGTCGACGCCATCCGAGGCAACTGGGGTGGC
ACACCTTACAAAGACCTCGTCATGTGCTTCGAGTATCTGGAGAGGGAGGTCGAGTACATTGACACGGATCGTGCC
GTGGCTCTTGGGGGCTCGTACGGCGGTTACATGATCAACTGGATCCAGGGCCATGAGCTGGGACGAAAGTTCAAG
GCGCTGGTTTGTCACGACGGCGTCTTCTCCACGCAAAACCAGTGGTCGACGGAGGAGCTATTCTTCCCCGAGCAT
GACTTTTGCGGAACGCTCTGGGACAACCGCAAGATGTACGCCAAGTGGGATCCGTCGCTGCACCTGGACAAGTGG
TCGACGCCGCAGCTGGTGATTCACAGCGAGCTCGACTACCGCCTGCCCATCTCGGAGGGTCTGGCCATGTTTAAT
GTGTTGCAGGCGCGCGGTGTGCCCAGCAAGCTTCTTGTTTTTCCGGACGAGAATCATTGGGTTACGAAGCCGGAG
AACTCGCTGGTCTGGCACCGGGAAGTGCTGGGCTGGATCAACAAGTATAGCGGCGTGGAAAAGACGACCGCGAGA
CGCGCCCCATCCGATGATAGGCGCATCCGCCCAGCACCTCAGCGGCGGCAGCAGCGCAACCATTCCACCATGGCA
GGCCAAGCAGCCCTCTATCACGCGCTGCTACGTCCCTCAATGCTGCAGATCCTCCGAGCGACGGGATACCACGCG
ACCAAGGGCGCCGTCCTAGACTCTGTGACGGATCTGGCAGCCCGCTACCTGTACGCTCTCTGCGAGGCGACGGCC
GCCCACGCCGCTCACAACCACGGCTCGGGCGATTTCACCGCTGCCGACATGGGGTTCGCCCTGCGCGATGTCGGC
GCTCTGCTTCCTGAGGGGAGGTCTGGCGAGGATGTGAGGGGGGTGGATGACTTTCTGAGATGGTTTGCGGGGGGG
AGGATGAGGGAGATTGCGGAGATGGGGAGGGAGGGTGAGGCTGATGCGACGGATTATCTTGCTGCGCTCAAGAAG
AAGCATAGCAAGACGGGCGACGATAACAAGTACCACGGCACCCTCATCGGCAGATTCGCAGACACAGCCTGCGAG
ATCCAAGTCGAAGGCGGGACCGAGTCCTCCATCGACGAATGGGTCATGCACAGAAGCAGCCTGTTCTTCGACCCG
CCCACCCCGCCCCTCCGTCCGGCACCGGCACCGACGCGACTTCCGCTGCCTCCACCGGCGCGGGACGATGATGAG
GATGATGTGGCGCGGTTCTGA
Gene >Ophun1|6152
ATGTCGTACTCTTTTGAGACGCATTCGAGGTCGTCGTCCATCCGAGTTCTGGACATCAACAACGCCTCATCCCAT
CTCATTGCGGACGACGCCGAGGCTAGCGACCCGGTCTGGATCGGCGACGAGGAGGTGCTTTACTTCAAAGCAGGC
GGCAATTCGGAGACGTTGATGTATGCTCGCCAAGTCGGGAGTCAATCCGAGTAAGTCGACGCAGCCTTCCCTCGT
GGGCCCTCAGACGCTGACTTCTGCAGACCGCAACTGGTTCACAAGCTCAAAGGCAGCGTCTTCGCCCCCAAGACC
AAGCAGTTGTCGGACGGAAAGGTTGCCATCTGCTGTGCTGCAGTGACGACGCCCGCCGGTCAAATGCTTTGGCAG
CCTCGCGAGACCAAGCCTCACTCGTCCGCCAAGGTTTACTCATCGCTCTTCGTTCGCCACTGGGATGCCTGGGAG
ACGAAGAATTCAAACTCCATTTGGTACGGTCAGCTCTCCAAACAGGATGGCAAGTGGAAGCTCGACGGGCCCGGC
CTCACCAACCTGCTCGCGGGTACCTGTCTCGTCTCGCCCGTTCCCAACTTTGGCGGCGCCAATGACTACGACATT
GCCGACAATGCAATCTGCTTCGTAGCCAAGGATCCAAACCTCAATCCCGCCCGGTACACCAAGTCAGATCTCTAC
TATGCGCCCATCTATTCCTTCGCCGATGGCTCCGCGGGTCCTATCGAGATGGTCGACGATCCTAAATCGCCCTAT
GAAGACTTTTTAGATGGCAGAATAATCACAAGGACTCAGAAGCTTCGCGGTTACGCGGGCCACCCGACCTTTTCC
AGGGATGGCAAAAAGATTGCTTATACGAAAATGAAGAGCGACCAGTACGAATCAGACAAGACGCGGCTTCTGATC
GTGCCCGACGTCGATGACTTGAGCAAGGTGCAAGAACTTCACGCGTCGAGATTTGGCCATGGCTCCTGGGACCGC
AGCCCGGACTCCATCAGCTGGAGCCACGACGACAAGGAGCTCTTCGTGACGGCCGAACAGTACGGCAGGGCTGTT
CTCTGGAGACTCCCGTCTTATCCCGACGAGAACCGTGAGCCGGAGCGTGTGTTTCGCCCGGAGGGTTCCGTCACG
GCCGCCAAACCCCTCGGCAAAGGCCCTTTGCTGCTCATTACGACTCGATCCCTGGTGGAGAGCTCCAACTACGCA
ACGTTCGATTACGGCACTGGGACCATGACTCAACTCTCGTCCATCACTAAGAATGGTAGGTCGTTGGGCTTGAGC
AGGTCGCAAGTGGATGAGCTTTGGACTCCCGGAAGCGACGCGACAGAGAATCACGCGCTGGTGGTCAAGCCTTCC
AACTTTGACAAGTCCAAAAAGTACCCCTTGGCTTTGTTAATCCACGGCGGGCCGCAGGGGGCTTGGACGGACGAC
TGGAGCACGCGCTGGAACCCGGCCGTCTTTGCCGAGCAGGGCTACGTGGTGGTGTGTCCCAACCCGACGGGCAGC
ACGGGCTACGGTCAGGAGCACGTCGACGCCATCCGAGGCAACTGGGGTGGCACACCTTACAAAGACCTCGTCATG
TGCTTCGAGTATCTGGAGAGGGAGGTCGAGTACATTGACACGGATCGTGCCGTGGCTCTTGGGGGCTCGTACGGC
GGTTACATGATCAGTGAGTCGAAACGGAGAGCTGGTTTCGATGGCGGAAGACTGACTCGCTTTGCAGACTGGATC
CAGGGCCATGAGCTGGGACGAAAGTTCAAGGCGCTGGTTTGTCACGACGGCGTCTTCTCCACGCAAAACCAGTGG
TCGACGGAGGAGCTATTCTTCCCCGAGCATGACTTTTGCGGAACGCTCTGGGACAACCGCAAGATGTACGCCAAG
TGGGATCCGTCGCTGCACCTGGACAAGTGGTCGACGCCGCAGCTGGTGATTCACAGCGAGCTCGACTACCGCCTG
CCCATCTCGGAGGGTCTGGCCATGTTTAATGTGTTGCAGGCGCGCGGTGTGCCCAGCAAGCTTCTTGTTTTTCCG
GACGAGAATCATGTGAGTGACGGGCAGTCTGGGCTGTGCGTGTCCTGTTTCGCTGACTCTGGACGCAGTGGGTTA
CGAAGCCGGAGAACTCGCTGGTCTGGCACCGGGAAGTGCTGGGCTGGATCAACAAGTATAGCGGCGTGGAAAAGA
CGAGTGAGCGTGCGCTGTCTTGTCGGGCTAGGTCGTGATGCTTGCCCTACATCATACATGTCTATCAAGGTGTAC
GAAGTGTAGAGACGGGAGATGGGTTCTGAGTCTCCCGCACCCTACACTGTCGGGACAAGGGAGACTTGCATAGGT
ATATAGCTGTGGTGCTACCGTCATCGGAGGCAATGGATATTCAGGTATCTCTCAGACCAGTAGCCGAGAGGCAGT
TCCTCAGGAGGCATCATGATGAACATGGTGTGGTGTTGAACGACAGCACAGTGTTTAGTGCGTATAACCGTCCAC
GCACGGCAGCGGCGATAACCGGCCCGATGGATTGCTGTCTTCCACTCCAGTCTCATCGTCTTCGCTTCACCAGCT
GGTCTACAGAAACGCGCCCTCGCTTCTCACGACATGACGAGCCGCGAGACGCGCCCCATCCGATGATAGGCGCAT
CCGCCCAGCACCTCAGCGGCGGCAGCAGCGCAACCATTCCACCATGGCAGGCCAAGCAGCCCTCTATCACGCGCT
GCTACGTCCCTCAATGCTGCAGATCCTCCGAGCGACGGGATACCACGCGACCAAGGGCGCCGTCCTAGACTCTGT
GACGGATCTGGCAGCCCGCTACCTGTACGCTCTCTGCGAGGCGACGGCCGCCCACGCCGCTCACAACCACGGCTC
GGGCGATTTCACCGCTGCCGACATGGGGTTCGCCCTGCGCGATGTCGGCGCTCTGCTTCCTGAGGGGAGGTCTGG
CGAGGATGTGAGGGGGGTGGATGACTTTCTGAGATGGTTTGCGGGGGGGAGGATGAGGGAGATTGCGGAGATGGG
GAGGGAGGGTGAGGCTGATGCGACGGATTATCTTGCTGGTGAGCCTTTTCCCCTTTTTTCTCGGTTTGTTCTTGG
TTGGTGTGGGCTAATCGGGGGGGGGGGGGCTGGCAGCGCTCAAGAAGAAGCATAGCAAGACGGGCGACGATAACA
AGTACCACGGCACCCTCATCGGCAGATTCGCAGACACAGCCTGCGAGATCCAAGTCGAAGGCGGGACCGAGTCCT
CCATCGACGAATGGGTCATGCACAGAAGCAGCCTGTTCTTCGACCCGCCCACCCCGCCCCTCCGTCCGGCACCGG
CACCGACGCGACTTCCGCTGCCTCCACCGGCGCGGGACGATGATGAGGATGATGTGGCGCGGGTGAATGGCGAGG
AGGGGCGTGCTTGTTCGGTGGGGAGTGAGGGGGTGGACAAGGGAGGGGGAGGGTCGAGGAGAGGTTCTGGGGGGG
GGGAGGGCATGGTGGAAGTTGGGAGGGGAAGTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail