Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|615
Gene name
LocationContig_12:1930..3859
Strand-
Gene length (bp)1929
Transcript length (bp)1929
Coding sequence length (bp)1929
Protein length (aa) 643

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain 8.4E-52 248 429
PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain 2.5E-20 451 547
PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain 7.0E-07 585 624
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 5.7E-10 116 185

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07850|SUOX_CHICK Sulfite oxidase OS=Gallus gallus GN=SUOX PE=1 SV=3 107 621 2.0E-121
sp|P51687|SUOX_HUMAN Sulfite oxidase, mitochondrial OS=Homo sapiens GN=SUOX PE=1 SV=2 128 624 9.0E-116
sp|Q60HD0|SUOX_MACFA Sulfite oxidase, mitochondrial OS=Macaca fascicularis GN=SUOX PE=2 SV=3 128 624 4.0E-114
sp|Q07116|SUOX_RAT Sulfite oxidase, mitochondrial OS=Rattus norvegicus GN=Suox PE=1 SV=2 116 624 3.0E-113
sp|Q8R086|SUOX_MOUSE Sulfite oxidase, mitochondrial OS=Mus musculus GN=Suox PE=1 SV=2 112 624 9.0E-113
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07850|SUOX_CHICK Sulfite oxidase OS=Gallus gallus GN=SUOX PE=1 SV=3 107 621 2.0E-121
sp|P51687|SUOX_HUMAN Sulfite oxidase, mitochondrial OS=Homo sapiens GN=SUOX PE=1 SV=2 128 624 9.0E-116
sp|Q60HD0|SUOX_MACFA Sulfite oxidase, mitochondrial OS=Macaca fascicularis GN=SUOX PE=2 SV=3 128 624 4.0E-114
sp|Q07116|SUOX_RAT Sulfite oxidase, mitochondrial OS=Rattus norvegicus GN=Suox PE=1 SV=2 116 624 3.0E-113
sp|Q8R086|SUOX_MOUSE Sulfite oxidase, mitochondrial OS=Mus musculus GN=Suox PE=1 SV=2 112 624 9.0E-113
sp|Q9VWP4|SUOX_DROME Probable sulfite oxidase, mitochondrial OS=Drosophila melanogaster GN=CG7280 PE=2 SV=1 109 624 1.0E-103
sp|Q9S850|SUOX_ARATH Sulfite oxidase OS=Arabidopsis thaliana GN=SOX PE=1 SV=1 205 624 5.0E-73
sp|P39868|NIA2_BRANA Nitrate reductase [NADH], clone PBNBR1412 OS=Brassica napus GN=NIA2 PE=2 SV=1 211 623 1.0E-51
sp|P39867|NIA1_BRANA Nitrate reductase [NADH], clone PBNBR1405 OS=Brassica napus GN=NIA1 PE=2 SV=1 211 623 2.0E-51
sp|P27968|NIA7_HORVU Nitrate reductase [NAD(P)H] OS=Hordeum vulgare GN=NAR-7 PE=2 SV=1 196 624 3.0E-51
sp|P17570|NIA_SOLLC Nitrate reductase [NADH] OS=Solanum lycopersicum GN=NIA PE=3 SV=1 211 624 5.0E-51
sp|P11832|NIA1_ARATH Nitrate reductase [NADH] 1 OS=Arabidopsis thaliana GN=NIA1 PE=1 SV=3 211 623 9.0E-51
sp|P39864|NIA_PHYIN Nitrate reductase [NADPH] OS=Phytophthora infestans GN=NIAA PE=3 SV=1 211 624 4.0E-50
sp|P43101|NIA_CICIN Nitrate reductase [NADH] OS=Cichorium intybus GN=NIA PE=2 SV=1 211 623 3.0E-48
sp|P36859|NIA_PETHY Nitrate reductase [NADH] OS=Petunia hybrida GN=NIA PE=2 SV=1 211 623 1.0E-47
sp|P11035|NIA2_ARATH Nitrate reductase [NADH] 2 OS=Arabidopsis thaliana GN=NIA2 PE=1 SV=1 211 623 2.0E-47
sp|P11605|NIA1_TOBAC Nitrate reductase [NADH] 1 OS=Nicotiana tabacum GN=NIA1 PE=3 SV=1 211 624 3.0E-47
sp|P39866|NIA2_PHAVU Nitrate reductase [NADH] 2 OS=Phaseolus vulgaris GN=NIA2 PE=3 SV=1 214 623 6.0E-47
sp|P08509|NIA2_TOBAC Nitrate reductase [NADH] 2 OS=Nicotiana tabacum GN=NIA2 PE=2 SV=2 211 624 1.0E-46
sp|P39869|NIA_LOTJA Nitrate reductase [NADH] OS=Lotus japonicus GN=NIA PE=3 SV=1 211 623 2.0E-46
sp|P27783|NIA_BETPN Nitrate reductase [NAD(P)H] OS=Betula pendula GN=NIA1 PE=2 SV=1 214 623 2.0E-46
sp|P49102|NIA3_MAIZE Nitrate reductase [NADH] 3 OS=Zea mays PE=3 SV=1 229 624 4.0E-46
sp|P39870|NIA2_SOYBN Inducible nitrate reductase [NADH] 2 OS=Glycine max GN=INR2 PE=2 SV=1 211 623 1.0E-45
sp|P23312|NIA_SPIOL Nitrate reductase [NADH] OS=Spinacia oleracea GN=NIA PE=2 SV=1 211 623 2.0E-45
sp|P17569|NIA_CUCMA Nitrate reductase [NADH] OS=Cucurbita maxima PE=2 SV=1 210 623 2.0E-45
sp|P39865|NIA1_PHAVU Nitrate reductase [NADH] 1 OS=Phaseolus vulgaris GN=NIA1 PE=3 SV=1 210 623 3.0E-45
sp|P16081|NIA1_ORYSJ Nitrate reductase [NADH] 1 OS=Oryza sativa subsp. japonica GN=NIA1 PE=2 SV=3 211 624 6.0E-45
sp|P54233|NIA1_SOYBN Inducible nitrate reductase [NADH] 1 OS=Glycine max GN=INR1 PE=2 SV=1 214 623 3.0E-44
sp|P27969|NIA2_HORVU Nitrate reductase [NADH] (Fragment) OS=Hordeum vulgare PE=2 SV=1 211 624 4.0E-44
sp|P27967|NIA1_HORVU Nitrate reductase [NADH] OS=Hordeum vulgare PE=3 SV=1 211 624 3.0E-43
sp|P36858|NIA_ASPNG Nitrate reductase [NADPH] OS=Aspergillus niger GN=niaD PE=3 SV=1 211 627 3.0E-42
sp|P36841|NIA_VOLCA Nitrate reductase [NADH] OS=Volvox carteri GN=NITA PE=2 SV=1 211 633 1.0E-40
sp|Q05531|NIA_USTMA Nitrate reductase [NADPH] OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NAR1 PE=2 SV=2 216 511 7.0E-40
sp|P39863|NIA_FUSOX Nitrate reductase [NADPH] OS=Fusarium oxysporum GN=NIA PE=3 SV=1 211 624 9.0E-40
sp|P22945|NIA_EMENI Nitrate reductase [NADPH] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=niaD PE=3 SV=1 211 627 9.0E-40
sp|P08619|NIA_NEUCR Nitrate reductase [NADPH] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-3 PE=1 SV=3 210 624 5.0E-38
sp|P36842|NIA_LEPMC Nitrate reductase [NADPH] OS=Leptosphaeria maculans GN=NIAD PE=3 SV=2 211 624 9.0E-38
sp|P49050|NIA_PICAN Nitrate reductase [NADPH] OS=Pichia angusta GN=YNR1 PE=1 SV=1 186 624 3.0E-34
sp|P43100|NIA_BEABA Nitrate reductase [NADPH] OS=Beauveria bassiana GN=NIA PE=3 SV=1 211 624 3.0E-33
sp|P17571|NIA1_MAIZE Nitrate reductase [NADH] (Fragment) OS=Zea mays PE=1 SV=2 396 623 9.0E-16
sp|O32103|YUIH_BACSU Uncharacterized oxidoreductase YuiH OS=Bacillus subtilis (strain 168) GN=yuiH PE=3 SV=1 327 447 2.0E-08
sp|Q9HFV1|CYB5_RHIST Cytochrome b5 OS=Rhizopus stolonifer PE=2 SV=1 112 184 5.0E-07
sp|P00173|CYB5_RAT Cytochrome b5 OS=Rattus norvegicus GN=Cyb5a PE=1 SV=2 101 190 6.0E-07
sp|P56395|CYB5_MOUSE Cytochrome b5 OS=Mus musculus GN=Cyb5a PE=1 SV=2 106 190 1.0E-06
sp|P00168|CYB5_ALOSE Cytochrome b5 (Fragment) OS=Alouatta seniculus GN=CYB5A PE=1 SV=2 106 190 1.0E-06
sp|P04166|CYB5B_RAT Cytochrome b5 type B OS=Rattus norvegicus GN=Cyb5b PE=1 SV=2 106 191 4.0E-06
sp|Q9ZNV4|CYB5C_ARATH Cytochrome B5 isoform C OS=Arabidopsis thaliana GN=CYTB5-C PE=1 SV=1 115 208 5.0E-06
sp|P00172|CYB5_PIG Cytochrome b5 OS=Sus scrofa GN=CYB5A PE=1 SV=3 101 190 8.0E-06
sp|Q9CQX2|CYB5B_MOUSE Cytochrome b5 type B OS=Mus musculus GN=Cyb5b PE=1 SV=1 106 191 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0030151 molybdenum ion binding Yes
GO:0046872 metal ion binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|615
MSQPAASCLARRLRLFQTPRLPIRLPYQQQNRSVSFSFNSRGPKTSHETRRAALGGVIAAFVSCSAFFLSSDSIP
VASFVAQTSSASADVTRSSPEIKSAIPDTRDPSLPRFRIHDIRKHGPDSDRPWVIRADKVYDITDWVPAHPGGQV
ILRAAGGSIDAYWDIFTIHKEQYVYEILEQYLIGFVHQDDLVDGRPAREQIEDPFAKDPIRHPALMVRTAKPCNA
ETPPEALADHFLTPNELFYVRNHMWVPKVEAAASDSHVLTVELPDGTLKQYTLNDLKTKFPSRKVTAVLQCSGNR
RRHMTQGSGRSTNGLQWAAGAISNASWEGVLLADVLADAGFDTARALAGEGETKHVHLAGMEAYGASIPLKKAVD
PQGDVLLAYSMNDAVLPPDHGFPLRAIVPGHVAARSVKWLSHITLSEDESTSQWQRRDYKCFGPNQTKVDWDAAP
AIQELPVQSAITAVKTNGWVGSAEPAQKVSLGGYAFSGGGRSIIRVDVSLDNGRSWTQARLLPDINDDDDDDDES
RPSSHGHGAWSWKRWRLDASIPLSAFSERDQRRAYPIDVKPEAPEKTERGEGRGEDAATRCTTVLVKATDDAYNC
QPESHAATWNLRGNLATAWHRIQLCADCSAGGLARREGEVNG*
Coding >Ophun1|615
ATGAGCCAACCAGCCGCGAGCTGCCTCGCCCGCCGACTGCGGCTCTTTCAAACACCCCGGCTTCCGATCAGGCTT
CCGTATCAGCAGCAGAACCGCTCAGTGAGCTTCTCATTCAACAGTCGCGGACCAAAGACGTCACATGAGACGAGA
CGGGCCGCGCTCGGCGGCGTCATCGCCGCCTTCGTCTCCTGCTCCGCATTCTTCCTCTCGTCCGATTCAATCCCG
GTCGCCTCCTTCGTCGCCCAGACGTCTTCGGCCTCTGCCGACGTGACGCGCTCATCGCCGGAGATCAAGTCGGCC
ATCCCCGATACACGAGACCCCAGCCTCCCGCGCTTCCGCATCCATGATATCCGAAAACACGGCCCCGACTCGGAC
AGGCCGTGGGTCATTCGCGCCGACAAGGTGTACGACATTACCGATTGGGTCCCCGCTCATCCCGGCGGCCAGGTC
ATTCTCCGAGCCGCTGGCGGATCCATCGACGCTTACTGGGACATCTTCACCATTCACAAGGAGCAGTATGTCTAT
GAAATTCTCGAGCAGTACCTCATCGGCTTCGTTCATCAAGACGACCTCGTCGACGGACGCCCAGCTCGGGAACAG
ATCGAGGATCCCTTCGCCAAAGACCCCATCAGGCATCCGGCCCTCATGGTGCGCACCGCGAAGCCCTGCAACGCC
GAGACCCCCCCGGAAGCCCTGGCCGATCACTTTCTCACCCCCAACGAACTCTTCTACGTCCGCAACCATATGTGG
GTGCCAAAAGTCGAGGCGGCCGCCTCTGACAGCCATGTCCTGACGGTCGAGCTCCCTGACGGCACCCTCAAGCAG
TACACGCTCAACGACCTCAAGACCAAGTTCCCCAGCCGCAAGGTGACGGCCGTGCTGCAATGCTCGGGGAATCGC
CGCAGACACATGACGCAGGGCTCCGGCCGGTCCACAAACGGCCTACAGTGGGCAGCCGGCGCCATATCCAACGCC
TCGTGGGAGGGCGTGCTGCTGGCCGATGTGCTGGCCGATGCCGGCTTCGACACGGCACGCGCTCTGGCCGGAGAG
GGCGAGACCAAGCACGTCCACCTGGCCGGCATGGAGGCCTACGGTGCTTCGATCCCCCTTAAGAAGGCCGTTGAT
CCGCAGGGCGACGTCCTGCTGGCCTACTCGATGAACGATGCCGTCCTACCGCCAGATCACGGGTTTCCCTTGCGG
GCCATCGTCCCCGGCCACGTGGCTGCGCGATCCGTCAAGTGGCTCAGCCACATCACGCTCAGCGAGGACGAGAGC
ACCAGCCAGTGGCAGCGCCGAGACTACAAGTGCTTCGGCCCCAACCAGACCAAGGTCGACTGGGACGCCGCCCCA
GCCATCCAGGAGCTCCCCGTACAGAGCGCCATCACAGCCGTCAAGACGAACGGCTGGGTCGGAAGCGCAGAGCCG
GCTCAGAAGGTGTCGCTCGGCGGCTACGCCTTCTCCGGAGGCGGACGCTCCATCATCCGCGTCGACGTCTCCCTC
GATAACGGCCGCTCCTGGACGCAAGCCCGTCTCCTACCGGACATCAACGACGACGACGACGACGACGACGAATCC
CGTCCATCCAGCCACGGACACGGCGCGTGGAGCTGGAAGAGATGGCGCCTCGACGCCAGCATCCCGCTCTCCGCC
TTTTCCGAGCGCGACCAGCGCCGCGCATATCCGATAGACGTCAAGCCCGAAGCCCCTGAAAAGACGGAAAGGGGG
GAGGGTCGCGGCGAGGATGCAGCGACGAGGTGTACGACGGTCCTCGTCAAGGCCACCGACGACGCCTACAACTGT
CAGCCCGAGAGTCACGCCGCGACGTGGAATCTGCGCGGCAACCTGGCGACGGCCTGGCATCGTATTCAGCTCTGT
GCTGATTGCTCGGCTGGAGGGTTGGCCAGGAGGGAGGGGGAAGTGAATGGTTAG
Transcript >Ophun1|615
ATGAGCCAACCAGCCGCGAGCTGCCTCGCCCGCCGACTGCGGCTCTTTCAAACACCCCGGCTTCCGATCAGGCTT
CCGTATCAGCAGCAGAACCGCTCAGTGAGCTTCTCATTCAACAGTCGCGGACCAAAGACGTCACATGAGACGAGA
CGGGCCGCGCTCGGCGGCGTCATCGCCGCCTTCGTCTCCTGCTCCGCATTCTTCCTCTCGTCCGATTCAATCCCG
GTCGCCTCCTTCGTCGCCCAGACGTCTTCGGCCTCTGCCGACGTGACGCGCTCATCGCCGGAGATCAAGTCGGCC
ATCCCCGATACACGAGACCCCAGCCTCCCGCGCTTCCGCATCCATGATATCCGAAAACACGGCCCCGACTCGGAC
AGGCCGTGGGTCATTCGCGCCGACAAGGTGTACGACATTACCGATTGGGTCCCCGCTCATCCCGGCGGCCAGGTC
ATTCTCCGAGCCGCTGGCGGATCCATCGACGCTTACTGGGACATCTTCACCATTCACAAGGAGCAGTATGTCTAT
GAAATTCTCGAGCAGTACCTCATCGGCTTCGTTCATCAAGACGACCTCGTCGACGGACGCCCAGCTCGGGAACAG
ATCGAGGATCCCTTCGCCAAAGACCCCATCAGGCATCCGGCCCTCATGGTGCGCACCGCGAAGCCCTGCAACGCC
GAGACCCCCCCGGAAGCCCTGGCCGATCACTTTCTCACCCCCAACGAACTCTTCTACGTCCGCAACCATATGTGG
GTGCCAAAAGTCGAGGCGGCCGCCTCTGACAGCCATGTCCTGACGGTCGAGCTCCCTGACGGCACCCTCAAGCAG
TACACGCTCAACGACCTCAAGACCAAGTTCCCCAGCCGCAAGGTGACGGCCGTGCTGCAATGCTCGGGGAATCGC
CGCAGACACATGACGCAGGGCTCCGGCCGGTCCACAAACGGCCTACAGTGGGCAGCCGGCGCCATATCCAACGCC
TCGTGGGAGGGCGTGCTGCTGGCCGATGTGCTGGCCGATGCCGGCTTCGACACGGCACGCGCTCTGGCCGGAGAG
GGCGAGACCAAGCACGTCCACCTGGCCGGCATGGAGGCCTACGGTGCTTCGATCCCCCTTAAGAAGGCCGTTGAT
CCGCAGGGCGACGTCCTGCTGGCCTACTCGATGAACGATGCCGTCCTACCGCCAGATCACGGGTTTCCCTTGCGG
GCCATCGTCCCCGGCCACGTGGCTGCGCGATCCGTCAAGTGGCTCAGCCACATCACGCTCAGCGAGGACGAGAGC
ACCAGCCAGTGGCAGCGCCGAGACTACAAGTGCTTCGGCCCCAACCAGACCAAGGTCGACTGGGACGCCGCCCCA
GCCATCCAGGAGCTCCCCGTACAGAGCGCCATCACAGCCGTCAAGACGAACGGCTGGGTCGGAAGCGCAGAGCCG
GCTCAGAAGGTGTCGCTCGGCGGCTACGCCTTCTCCGGAGGCGGACGCTCCATCATCCGCGTCGACGTCTCCCTC
GATAACGGCCGCTCCTGGACGCAAGCCCGTCTCCTACCGGACATCAACGACGACGACGACGACGACGACGAATCC
CGTCCATCCAGCCACGGACACGGCGCGTGGAGCTGGAAGAGATGGCGCCTCGACGCCAGCATCCCGCTCTCCGCC
TTTTCCGAGCGCGACCAGCGCCGCGCATATCCGATAGACGTCAAGCCCGAAGCCCCTGAAAAGACGGAAAGGGGG
GAGGGTCGCGGCGAGGATGCAGCGACGAGGTGTACGACGGTCCTCGTCAAGGCCACCGACGACGCCTACAACTGT
CAGCCCGAGAGTCACGCCGCGACGTGGAATCTGCGCGGCAACCTGGCGACGGCCTGGCATCGTATTCAGCTCTGT
GCTGATTGCTCGGCTGGAGGGTTGGCCAGGAGGGAGGGGGAAGTGAATGGTTAG
Gene >Ophun1|615
ATGAGCCAACCAGCCGCGAGCTGCCTCGCCCGCCGACTGCGGCTCTTTCAAACACCCCGGCTTCCGATCAGGCTT
CCGTATCAGCAGCAGAACCGCTCAGTGAGCTTCTCATTCAACAGTCGCGGACCAAAGACGTCACATGAGACGAGA
CGGGCCGCGCTCGGCGGCGTCATCGCCGCCTTCGTCTCCTGCTCCGCATTCTTCCTCTCGTCCGATTCAATCCCG
GTCGCCTCCTTCGTCGCCCAGACGTCTTCGGCCTCTGCCGACGTGACGCGCTCATCGCCGGAGATCAAGTCGGCC
ATCCCCGATACACGAGACCCCAGCCTCCCGCGCTTCCGCATCCATGATATCCGAAAACACGGCCCCGACTCGGAC
AGGCCGTGGGTCATTCGCGCCGACAAGGTGTACGACATTACCGATTGGGTCCCCGCTCATCCCGGCGGCCAGGTC
ATTCTCCGAGCCGCTGGCGGATCCATCGACGCTTACTGGGACATCTTCACCATTCACAAGGAGCAGTATGTCTAT
GAAATTCTCGAGCAGTACCTCATCGGCTTCGTTCATCAAGACGACCTCGTCGACGGACGCCCAGCTCGGGAACAG
ATCGAGGATCCCTTCGCCAAAGACCCCATCAGGCATCCGGCCCTCATGGTGCGCACCGCGAAGCCCTGCAACGCC
GAGACCCCCCCGGAAGCCCTGGCCGATCACTTTCTCACCCCCAACGAACTCTTCTACGTCCGCAACCATATGTGG
GTGCCAAAAGTCGAGGCGGCCGCCTCTGACAGCCATGTCCTGACGGTCGAGCTCCCTGACGGCACCCTCAAGCAG
TACACGCTCAACGACCTCAAGACCAAGTTCCCCAGCCGCAAGGTGACGGCCGTGCTGCAATGCTCGGGGAATCGC
CGCAGACACATGACGCAGGGCTCCGGCCGGTCCACAAACGGCCTACAGTGGGCAGCCGGCGCCATATCCAACGCC
TCGTGGGAGGGCGTGCTGCTGGCCGATGTGCTGGCCGATGCCGGCTTCGACACGGCACGCGCTCTGGCCGGAGAG
GGCGAGACCAAGCACGTCCACCTGGCCGGCATGGAGGCCTACGGTGCTTCGATCCCCCTTAAGAAGGCCGTTGAT
CCGCAGGGCGACGTCCTGCTGGCCTACTCGATGAACGATGCCGTCCTACCGCCAGATCACGGGTTTCCCTTGCGG
GCCATCGTCCCCGGCCACGTGGCTGCGCGATCCGTCAAGTGGCTCAGCCACATCACGCTCAGCGAGGACGAGAGC
ACCAGCCAGTGGCAGCGCCGAGACTACAAGTGCTTCGGCCCCAACCAGACCAAGGTCGACTGGGACGCCGCCCCA
GCCATCCAGGAGCTCCCCGTACAGAGCGCCATCACAGCCGTCAAGACGAACGGCTGGGTCGGAAGCGCAGAGCCG
GCTCAGAAGGTGTCGCTCGGCGGCTACGCCTTCTCCGGAGGCGGACGCTCCATCATCCGCGTCGACGTCTCCCTC
GATAACGGCCGCTCCTGGACGCAAGCCCGTCTCCTACCGGACATCAACGACGACGACGACGACGACGACGAATCC
CGTCCATCCAGCCACGGACACGGCGCGTGGAGCTGGAAGAGATGGCGCCTCGACGCCAGCATCCCGCTCTCCGCC
TTTTCCGAGCGCGACCAGCGCCGCGCATATCCGATAGACGTCAAGCCCGAAGCCCCTGAAAAGACGGAAAGGGGG
GAGGGTCGCGGCGAGGATGCAGCGACGAGGTGTACGACGGTCCTCGTCAAGGCCACCGACGACGCCTACAACTGT
CAGCCCGAGAGTCACGCCGCGACGTGGAATCTGCGCGGCAACCTGGCGACGGCCTGGCATCGTATTCAGCTCTGT
GCTGATTGCTCGGCTGGAGGGTTGGCCAGGAGGGAGGGGGAAGTGAATGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail