Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6143
Gene name
LocationContig_65:30352..32676
Strand-
Gene length (bp)2324
Transcript length (bp)2223
Coding sequence length (bp)2223
Protein length (aa) 741

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19834 DUF6314 Family of unknown function (DUF6314) 1.0E-31 563 740
PF00743 FMO-like Flavin-binding monooxygenase-like 5.8E-13 2 208
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 2.9E-11 3 209
PF13454 NAD_binding_9 FAD-NAD(P)-binding 3.3E-08 7 150
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.4E-06 7 52

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99518|FMO2_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Homo sapiens GN=FMO2 PE=1 SV=4 1 210 2.0E-12
sp|Q8SPQ7|FMO3_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Macaca mulatta GN=FMO3 PE=2 SV=3 1 496 2.0E-12
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 1 233 3.0E-12
sp|P36366|FMO2_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Cavia porcellus GN=FMO2 PE=2 SV=2 1 210 3.0E-12
sp|Q04799|FMO5_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Oryctolagus cuniculus GN=FMO5 PE=1 SV=2 2 543 5.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99518|FMO2_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Homo sapiens GN=FMO2 PE=1 SV=4 1 210 2.0E-12
sp|Q8SPQ7|FMO3_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Macaca mulatta GN=FMO3 PE=2 SV=3 1 496 2.0E-12
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 1 233 3.0E-12
sp|P36366|FMO2_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Cavia porcellus GN=FMO2 PE=2 SV=2 1 210 3.0E-12
sp|Q04799|FMO5_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Oryctolagus cuniculus GN=FMO5 PE=1 SV=2 2 543 5.0E-12
sp|P97501|FMO3_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Mus musculus GN=Fmo3 PE=1 SV=1 1 500 5.0E-12
sp|Q8HZ69|FMO2_GORGO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Gorilla gorilla gorilla GN=FMO2 PE=3 SV=3 1 210 6.0E-12
sp|Q9EQ76|FMO3_RAT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Rattus norvegicus GN=Fmo3 PE=1 SV=1 1 208 6.0E-12
sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 1 215 7.0E-12
sp|Q95LA2|FMO1_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Canis lupus familiaris GN=FMO1 PE=2 SV=3 1 204 7.0E-12
sp|Q28505|FMO2_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Macaca mulatta GN=FMO2 PE=2 SV=2 1 204 1.0E-11
sp|Q9SS04|GSOX1_ARATH Flavin-containing monooxygenase FMO GS-OX1 OS=Arabidopsis thaliana GN=FMOGS-OX1 PE=2 SV=1 2 216 2.0E-11
sp|P31512|FMO4_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Homo sapiens GN=FMO4 PE=1 SV=3 1 495 2.0E-11
sp|Q6IRI9|FMO2_RAT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Rattus norvegicus GN=Fmo2 PE=2 SV=3 1 208 2.0E-11
sp|Q8K4B7|FMO4_RAT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Rattus norvegicus GN=Fmo4 PE=2 SV=3 1 375 3.0E-11
sp|Q8K2I3|FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus GN=Fmo2 PE=1 SV=3 1 208 3.0E-11
sp|P17636|FMO1_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Oryctolagus cuniculus GN=FMO1 PE=1 SV=3 1 204 9.0E-11
sp|Q01740|FMO1_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Homo sapiens GN=FMO1 PE=2 SV=3 1 212 1.0E-10
sp|Q95LA1|FMO3_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Canis lupus familiaris GN=FMO3 PE=2 SV=3 1 208 1.0E-10
sp|Q9SXE1|GSOX3_ARATH Flavin-containing monooxygenase FMO GS-OX3 OS=Arabidopsis thaliana GN=FMOGS-OX3 PE=2 SV=1 2 218 3.0E-10
sp|Q8VHG0|FMO4_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Mus musculus GN=Fmo4 PE=1 SV=3 1 215 5.0E-10
sp|Q9LMA1|FMO1_ARATH Probable flavin-containing monooxygenase 1 OS=Arabidopsis thaliana GN=FMO1 PE=2 SV=1 5 423 7.0E-10
sp|O60774|FMO6_HUMAN Putative dimethylaniline monooxygenase [N-oxide-forming] 6 OS=Homo sapiens GN=FMO6P PE=5 SV=1 1 204 8.0E-10
sp|Q8K4C0|FMO5_RAT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Rattus norvegicus GN=Fmo5 PE=1 SV=3 3 552 8.0E-10
sp|P38866|FMO1_YEAST Thiol-specific monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMO1 PE=1 SV=2 30 220 4.0E-09
sp|P50285|FMO1_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Mus musculus GN=Fmo1 PE=1 SV=1 1 212 4.0E-09
sp|P97872|FMO5_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Mus musculus GN=Fmo5 PE=1 SV=4 3 552 9.0E-09
sp|O64489|YUC9_ARATH Probable indole-3-pyruvate monooxygenase YUCCA9 OS=Arabidopsis thaliana GN=YUC9 PE=2 SV=1 7 241 9.0E-09
sp|Q8HYJ9|FMO3_BOVIN Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Bos taurus GN=FMO3 PE=2 SV=1 1 496 1.0E-07
sp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 7 213 2.0E-07
sp|P36365|FMO1_RAT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Rattus norvegicus GN=Fmo1 PE=1 SV=2 1 212 2.0E-07
sp|Q9FWW6|GSXL1_ARATH Flavin-containing monooxygenase FMO GS-OX-like 1 OS=Arabidopsis thaliana GN=At1g12160 PE=2 SV=1 2 213 3.0E-07
sp|P31513|FMO3_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Homo sapiens GN=FMO3 PE=1 SV=5 1 496 1.0E-06
sp|Q7YS44|FMO3_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Pan troglodytes GN=FMO3 PE=3 SV=3 1 496 1.0E-06
sp|A7Z1S7|CZCO_BACMF Uncharacterized oxidoreductase CzcO OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=czcO PE=3 SV=1 6 204 1.0E-06
sp|Q9LKC0|YUC5_ARATH Probable indole-3-pyruvate monooxygenase YUCCA5 OS=Arabidopsis thaliana GN=YUC5 PE=2 SV=1 7 215 1.0E-06
sp|P49326|FMO5_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Homo sapiens GN=FMO5 PE=1 SV=2 3 149 2.0E-06
sp|P32417|FMO3_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Oryctolagus cuniculus GN=FMO3 PE=1 SV=3 1 208 3.0E-06
sp|Q9FWW3|GSXL6_ARATH Flavin-containing monooxygenase FMO GS-OX-like 6 OS=Arabidopsis thaliana GN=At1g12130 PE=2 SV=1 2 208 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0050661 NADP binding Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0005488 binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0000166 nucleotide binding No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0003674 molecular_function No
GO:0004497 monooxygenase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1643
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3543
Ophiocordyceps australis map64 (Brazil) OphauB2|1086
Ophiocordyceps camponoti-floridani Ophcf2|03619
Ophiocordyceps camponoti-rufipedis Ophun1|6143 (this protein)
Ophiocordyceps kimflemingae Ophio5|17
Ophiocordyceps subramaniannii Hirsu2|1335

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6143
MAKSVCVVGAGPSGLVAAKTFLHNAPKGAFRVTVLDRQSAVGGLWPSSVADRRRQIDPLMLANQSRYTMHFSDLA
WEDDAPPVPRAHQVGKYLHRYLDRYLTPHPDFQLRLETQLVRAIQSRDAWELLLKAKGGNETAVFDYLLVASGHF
GKPMSLPGFLEPPQAVPVIHSCQYRDLKSLLGSNPPPNGKVLVVGGQMSGVEIAGTIAAHLSSAANSPGETIIPG
IDGYSVHHIVQRPSWVFPIFTTPEPEAAAPPFLPLDFSHYNLNNRPPPLTNTQGHIRQDAAQAVHAYFHDSLGGD
QSVFSPLLCVDDEARSQPPYMVVSDWYCNFVRSGLITLSKGKLDSLQGSTAIVSPERTEVHNIAAVVLATGFDPS
PSLSFLSQDLLRKLHHSASHPSQPLALSFHATHHPDVPGLGFVGFYRSPYWGVMQMQSRFLAEFWSATDSPPRPL
LIKVALDDSVARTLALRDDVRVSQFPMGDYPWLMQELAEALAIEPQAVSLEGLPLLPHNRLPLDMLTPSRYTSPS
DDGPARAEAAKSVRNTVETTSTSLTSPKFVAWAVFRSLQGSWNLERKLVSRLPSHPSGHFTGTAKFLLREATSDG
MRCAVPDAATPTDGEPAFGWPAVEYLYVEEGEFKTDSGLAFRATRRYIWRYDEQRDVLSTWFAKTDDPNRADYLF
HEMEFRPRQPGHDAWKATAGHLCIQDYYDVGYDFSFKAVNLEKWAIEYTVKGPKKDYSIRGAYSR*
Coding >Ophun1|6143
ATGGCCAAGTCGGTCTGCGTCGTCGGCGCCGGCCCCTCTGGCCTTGTGGCCGCCAAGACCTTCCTCCACAATGCG
CCCAAAGGAGCCTTTCGTGTCACCGTTCTGGACCGCCAGAGCGCCGTCGGAGGCTTATGGCCGTCGTCTGTCGCC
GATCGCCGCCGCCAGATTGATCCTCTGATGCTCGCCAACCAGAGCCGTTATACAATGCACTTTAGTGATCTGGCC
TGGGAAGACGACGCGCCGCCTGTCCCTCGCGCCCATCAAGTTGGCAAATATCTGCACCGCTATCTCGATCGCTAC
CTGACACCGCATCCGGACTTTCAACTGCGATTGGAAACGCAGTTGGTGCGTGCTATTCAGAGCCGTGATGCCTGG
GAGCTGCTCTTGAAAGCCAAAGGAGGGAATGAGACAGCCGTCTTCGACTATCTTTTGGTGGCTTCGGGACACTTT
GGAAAGCCAATGTCGCTGCCAGGCTTTCTCGAACCACCACAGGCCGTTCCCGTTATCCACAGCTGTCAGTATCGC
GACCTGAAGAGCTTGCTGGGCAGCAACCCGCCTCCAAATGGAAAAGTGCTCGTTGTCGGAGGGCAAATGTCTGGT
GTTGAGATTGCCGGCACCATCGCCGCTCACCTTTCTTCAGCTGCCAACTCGCCCGGCGAGACTATCATTCCCGGG
ATCGATGGATACTCGGTTCATCATATCGTCCAACGACCATCCTGGGTCTTTCCCATCTTCACCACTCCCGAGCCC
GAGGCCGCAGCACCCCCCTTTCTACCCCTGGATTTCTCGCACTACAACTTGAATAACCGGCCCCCTCCCTTGACC
AACACGCAAGGACACATCAGACAAGATGCTGCCCAGGCAGTTCACGCCTACTTCCACGACAGCCTGGGCGGCGAT
CAATCAGTCTTCTCTCCTCTCCTCTGCGTCGACGATGAGGCAAGATCCCAACCACCGTACATGGTCGTCAGCGAC
TGGTACTGCAACTTTGTGCGATCCGGACTCATCACTCTTTCCAAGGGCAAACTCGATTCTTTACAGGGATCCACA
GCCATCGTCTCCCCTGAAAGAACAGAGGTGCATAACATCGCCGCCGTCGTCCTCGCAACCGGCTTCGACCCGTCT
CCCAGCCTGAGCTTCCTCTCCCAAGACCTTCTCCGCAAGCTGCACCACTCAGCCAGCCACCCAAGCCAACCGCTG
GCCCTATCTTTCCACGCCACCCATCACCCAGACGTACCAGGGCTTGGATTCGTCGGCTTCTACCGCTCGCCTTAC
TGGGGCGTGATGCAGATGCAGTCGAGATTCCTTGCTGAGTTCTGGTCGGCAACGGACTCGCCTCCCCGGCCGTTA
CTAATCAAGGTCGCACTCGACGACTCCGTTGCACGCACGCTAGCTCTGCGAGACGACGTCCGTGTCTCTCAATTT
CCCATGGGAGACTATCCCTGGCTCATGCAAGAGTTGGCTGAGGCGCTCGCCATCGAGCCCCAAGCCGTCTCGCTC
GAGGGACTGCCTCTCCTGCCCCACAACAGGCTACCCCTGGATATGCTGACGCCCTCACGCTACACGTCGCCCTCG
GACGACGGCCCTGCCAGAGCCGAGGCTGCAAAGTCAGTCCGGAACACGGTCGAGACCACATCCACCAGCCTGACA
TCCCCCAAGTTCGTTGCCTGGGCCGTCTTCCGCAGTCTGCAAGGCAGCTGGAACCTGGAACGCAAGCTCGTCAGT
AGATTACCCTCCCATCCTAGCGGGCACTTTACCGGCACTGCCAAGTTTCTACTTCGTGAGGCGACATCCGACGGC
ATGCGCTGCGCGGTGCCAGATGCGGCAACCCCGACGGACGGTGAGCCTGCCTTTGGCTGGCCGGCTGTCGAGTAT
CTCTACGTCGAAGAGGGGGAGTTCAAGACAGACTCCGGGCTCGCGTTCCGGGCTACGAGGCGGTATATCTGGCGG
TACGACGAGCAAAGAGATGTCCTGAGCACATGGTTCGCCAAGACAGACGACCCCAATCGAGCAGATTACCTCTTC
CACGAGATGGAGTTTCGCCCTCGACAACCGGGCCATGATGCCTGGAAGGCCACTGCAGGCCACCTCTGCATCCAA
GATTACTATGACGTCGGCTACGATTTCTCCTTCAAGGCGGTCAATCTGGAAAAGTGGGCGATAGAGTATACCGTC
AAGGGCCCCAAGAAGGACTATTCTATTCGCGGCGCCTACAGCCGGTAG
Transcript >Ophun1|6143
ATGGCCAAGTCGGTCTGCGTCGTCGGCGCCGGCCCCTCTGGCCTTGTGGCCGCCAAGACCTTCCTCCACAATGCG
CCCAAAGGAGCCTTTCGTGTCACCGTTCTGGACCGCCAGAGCGCCGTCGGAGGCTTATGGCCGTCGTCTGTCGCC
GATCGCCGCCGCCAGATTGATCCTCTGATGCTCGCCAACCAGAGCCGTTATACAATGCACTTTAGTGATCTGGCC
TGGGAAGACGACGCGCCGCCTGTCCCTCGCGCCCATCAAGTTGGCAAATATCTGCACCGCTATCTCGATCGCTAC
CTGACACCGCATCCGGACTTTCAACTGCGATTGGAAACGCAGTTGGTGCGTGCTATTCAGAGCCGTGATGCCTGG
GAGCTGCTCTTGAAAGCCAAAGGAGGGAATGAGACAGCCGTCTTCGACTATCTTTTGGTGGCTTCGGGACACTTT
GGAAAGCCAATGTCGCTGCCAGGCTTTCTCGAACCACCACAGGCCGTTCCCGTTATCCACAGCTGTCAGTATCGC
GACCTGAAGAGCTTGCTGGGCAGCAACCCGCCTCCAAATGGAAAAGTGCTCGTTGTCGGAGGGCAAATGTCTGGT
GTTGAGATTGCCGGCACCATCGCCGCTCACCTTTCTTCAGCTGCCAACTCGCCCGGCGAGACTATCATTCCCGGG
ATCGATGGATACTCGGTTCATCATATCGTCCAACGACCATCCTGGGTCTTTCCCATCTTCACCACTCCCGAGCCC
GAGGCCGCAGCACCCCCCTTTCTACCCCTGGATTTCTCGCACTACAACTTGAATAACCGGCCCCCTCCCTTGACC
AACACGCAAGGACACATCAGACAAGATGCTGCCCAGGCAGTTCACGCCTACTTCCACGACAGCCTGGGCGGCGAT
CAATCAGTCTTCTCTCCTCTCCTCTGCGTCGACGATGAGGCAAGATCCCAACCACCGTACATGGTCGTCAGCGAC
TGGTACTGCAACTTTGTGCGATCCGGACTCATCACTCTTTCCAAGGGCAAACTCGATTCTTTACAGGGATCCACA
GCCATCGTCTCCCCTGAAAGAACAGAGGTGCATAACATCGCCGCCGTCGTCCTCGCAACCGGCTTCGACCCGTCT
CCCAGCCTGAGCTTCCTCTCCCAAGACCTTCTCCGCAAGCTGCACCACTCAGCCAGCCACCCAAGCCAACCGCTG
GCCCTATCTTTCCACGCCACCCATCACCCAGACGTACCAGGGCTTGGATTCGTCGGCTTCTACCGCTCGCCTTAC
TGGGGCGTGATGCAGATGCAGTCGAGATTCCTTGCTGAGTTCTGGTCGGCAACGGACTCGCCTCCCCGGCCGTTA
CTAATCAAGGTCGCACTCGACGACTCCGTTGCACGCACGCTAGCTCTGCGAGACGACGTCCGTGTCTCTCAATTT
CCCATGGGAGACTATCCCTGGCTCATGCAAGAGTTGGCTGAGGCGCTCGCCATCGAGCCCCAAGCCGTCTCGCTC
GAGGGACTGCCTCTCCTGCCCCACAACAGGCTACCCCTGGATATGCTGACGCCCTCACGCTACACGTCGCCCTCG
GACGACGGCCCTGCCAGAGCCGAGGCTGCAAAGTCAGTCCGGAACACGGTCGAGACCACATCCACCAGCCTGACA
TCCCCCAAGTTCGTTGCCTGGGCCGTCTTCCGCAGTCTGCAAGGCAGCTGGAACCTGGAACGCAAGCTCGTCAGT
AGATTACCCTCCCATCCTAGCGGGCACTTTACCGGCACTGCCAAGTTTCTACTTCGTGAGGCGACATCCGACGGC
ATGCGCTGCGCGGTGCCAGATGCGGCAACCCCGACGGACGGTGAGCCTGCCTTTGGCTGGCCGGCTGTCGAGTAT
CTCTACGTCGAAGAGGGGGAGTTCAAGACAGACTCCGGGCTCGCGTTCCGGGCTACGAGGCGGTATATCTGGCGG
TACGACGAGCAAAGAGATGTCCTGAGCACATGGTTCGCCAAGACAGACGACCCCAATCGAGCAGATTACCTCTTC
CACGAGATGGAGTTTCGCCCTCGACAACCGGGCCATGATGCCTGGAAGGCCACTGCAGGCCACCTCTGCATCCAA
GATTACTATGACGTCGGCTACGATTTCTCCTTCAAGGCGGTCAATCTGGAAAAGTGGGCGATAGAGTATACCGTC
AAGGGCCCCAAGAAGGACTATTCTATTCGCGGCGCCTACAGCCGGTAG
Gene >Ophun1|6143
ATGGCCAAGTCGGTCTGCGTCGTCGGTAAGACCTATCCTTTCCATACTGCTACCATGCTTTACTCATGTTCTCCC
CTTCAGGCGCCGGCCCCTCTGGCCTTGTGGCCGCCAAGACCTTCCTCCACAATGCGCCCAAAGGAGCCTTTCGTG
TCACCGTTCTGGACCGCCAGAGCGCCGTCGGAGGCTTATGGCCGTCGTCTGTCGCCGATCGCCGCCGCCAGATTG
ATCCTCTGATGCTCGCCAACCAGAGCCGTTATACAATGCACTTTAGTGATCTGGCCTGGGAAGACGACGCGCCGC
CTGTCCCTCGCGCCCATCAAGTTGGCAAATATCTGCACCGCTATCTCGATCGCTACCTGACACCGCATCCGGACT
TTCAACTGCGATTGGAAACGCAGTTGGTGCGTGCTATTCAGAGCCGTGATGCCTGGGAGCTGCTCTTGAAAGCCA
AAGGAGGGAATGAGACAGCCGTCTTCGACTATCTTTTGGTGGCTTCGGGACACTTTGGAAAGCCAATGTCGCTGC
CAGGCTTTCTCGAACCACCACAGGCCGTTCCCGTTATCCACAGCTGTCAGTATCGCGACCTGAAGAGCTTGCTGG
GCAGCAACCCGCCTCCAAATGGAAAAGTGCTCGTTGTCGGAGGGCAAATGTCTGGTGTTGAGATTGCCGGCACCA
TCGCCGCTCACCTTTCTTCAGCTGCCAACTCGCCCGGCGAGACTATCATTCCCGGGATCGATGGATACTCGGTTC
ATCATATCGTCCAACGACCATCCTGGGTCTTTCCCATCTTCACCACTCCCGAGGTGAGGCTGCTTATCTGCGGTT
CCCGTCGTGGCTGACCGGAGCAGCCCGAGGCCGCAGCACCCCCCTTTCTACCCCTGGATTTCTCGCACTACAACT
TGAATAACCGGCCCCCTCCCTTGACCAACACGCAAGGACACATCAGACAAGATGCTGCCCAGGCAGTTCACGCCT
ACTTCCACGACAGCCTGGGCGGCGATCAATCAGTCTTCTCTCCTCTCCTCTGCGTCGACGATGAGGCAAGATCCC
AACCACCGTACATGGTCGTCAGCGACTGGTACTGCAACTTTGTGCGATCCGGACTCATCACTCTTTCCAAGGGCA
AACTCGATTCTTTACAGGGATCCACAGCCATCGTCTCCCCTGAAAGAACAGAGGTGCATAACATCGCCGCCGTCG
TCCTCGCAACCGGCTTCGACCCGTCTCCCAGCCTGAGCTTCCTCTCCCAAGACCTTCTCCGCAAGCTGCACCACT
CAGCCAGCCACCCAAGCCAACCGCTGGCCCTATCTTTCCACGCCACCCATCACCCAGACGTACCAGGGCTTGGAT
TCGTCGGCTTCTACCGCTCGCCTTACTGGGGCGTGATGCAGATGCAGTCGAGATTCCTTGCTGAGTTCTGGTCGG
CAACGGACTCGCCTCCCCGGCCGTTACTAATCAAGGTCGCACTCGACGACTCCGTTGCACGCACGCTAGCTCTGC
GAGACGACGTCCGTGTCTCTCAATTTCCCATGGGAGACTATCCCTGGCTCATGCAAGAGTTGGCTGAGGCGCTCG
CCATCGAGCCCCAAGCCGTCTCGCTCGAGGGACTGCCTCTCCTGCCCCACAACAGGCTACCCCTGGATATGCTGA
CGCCCTCACGCTACACGTCGCCCTCGGACGACGGCCCTGCCAGAGCCGAGGCTGCAAAGTCAGTCCGGAACACGG
TCGAGACCACATCCACCAGCCTGACATCCCCCAAGTTCGTTGCCTGGGCCGTCTTCCGCAGTCTGCAAGGCAGCT
GGAACCTGGAACGCAAGCTCGTCAGTAGATTACCCTCCCATCCTAGCGGGCACTTTACCGGCACTGCCAAGTTTC
TACTTCGTGAGGCGACATCCGACGGCATGCGCTGCGCGGTGCCAGATGCGGCAACCCCGACGGACGGTGAGCCTG
CCTTTGGCTGGCCGGCTGTCGAGTATCTCTACGTCGAAGAGGGGGAGTTCAAGACAGACTCCGGGCTCGCGTTCC
GGGCTACGAGGCGGTATATCTGGCGGTACGACGAGCAAAGAGATGTCCTGAGCACATGGTTCGCCAAGACAGACG
ACCCCAATCGAGCAGATTACCTCTTCCACGAGATGGAGTTTCGCCCTCGACAACCGGGCCATGATGCCTGGAAGG
CCACTGCAGGCCACCTCTGCATCCAAGATTACTATGACGTCGGCTACGATTTCTCCTTCAAGGCGGTCAATCTGG
AAAAGTGGGCGATAGAGTATACCGTCAAGGGCCCCAAGAAGGACTATTCTATTCGCGGCGCCTACAGCCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail