Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|614
Gene name
LocationContig_12:27..1704
Strand+
Gene length (bp)1677
Transcript length (bp)1605
Coding sequence length (bp)1605
Protein length (aa) 535

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18004 RPN2_C 26S proteasome regulatory subunit RPN2 C-terminal domain 2.8E-59 231 401
PF13646 HEAT_2 HEAT repeats 1.2E-14 45 137
PF01851 PC_rep Proteasome/cyclosome repeat 4.6E-09 96 130

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74762|RPN2_SCHPO 26S proteasome regulatory subunit rpn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn2 PE=1 SV=1 1 403 3.0E-131
sp|Q75CF3|RPN2_ASHGO 26S proteasome regulatory subunit RPN2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPN2 PE=3 SV=1 2 405 5.0E-120
sp|O48844|PSD1A_ARATH 26S proteasome non-ATPase regulatory subunit 1 homolog A OS=Arabidopsis thaliana GN=RPN2A PE=1 SV=1 1 401 4.0E-118
sp|Q9MAT0|PSD1B_ARATH 26S proteasome non-ATPase regulatory subunit 1 homolog B OS=Arabidopsis thaliana GN=RPN2B PE=1 SV=1 1 401 2.0E-117
sp|Q6FIP2|RPN2_CANGA 26S proteasome regulatory subunit RPN2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPN2 PE=3 SV=1 2 403 2.0E-116
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74762|RPN2_SCHPO 26S proteasome regulatory subunit rpn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn2 PE=1 SV=1 1 403 3.0E-131
sp|Q75CF3|RPN2_ASHGO 26S proteasome regulatory subunit RPN2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPN2 PE=3 SV=1 2 405 5.0E-120
sp|O48844|PSD1A_ARATH 26S proteasome non-ATPase regulatory subunit 1 homolog A OS=Arabidopsis thaliana GN=RPN2A PE=1 SV=1 1 401 4.0E-118
sp|Q9MAT0|PSD1B_ARATH 26S proteasome non-ATPase regulatory subunit 1 homolog B OS=Arabidopsis thaliana GN=RPN2B PE=1 SV=1 1 401 2.0E-117
sp|Q6FIP2|RPN2_CANGA 26S proteasome regulatory subunit RPN2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPN2 PE=3 SV=1 2 403 2.0E-116
sp|Q5R5S4|PSMD1_PONAB 26S proteasome non-ATPase regulatory subunit 1 OS=Pongo abelii GN=PSMD1 PE=2 SV=1 1 393 5.0E-116
sp|Q99460|PSMD1_HUMAN 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens GN=PSMD1 PE=1 SV=2 1 393 5.0E-116
sp|Q3TXS7|PSMD1_MOUSE 26S proteasome non-ATPase regulatory subunit 1 OS=Mus musculus GN=Psmd1 PE=1 SV=1 1 393 3.0E-115
sp|Q5F418|PSMD1_CHICK 26S proteasome non-ATPase regulatory subunit 1 OS=Gallus gallus GN=PSMD1 PE=2 SV=1 1 281 4.0E-115
sp|O88761|PSMD1_RAT 26S proteasome non-ATPase regulatory subunit 1 OS=Rattus norvegicus GN=Psmd1 PE=1 SV=1 1 393 8.0E-115
sp|Q9V3P6|PSMD1_DROME 26S proteasome non-ATPase regulatory subunit 1 OS=Drosophila melanogaster GN=Rpn2 PE=1 SV=1 1 403 4.0E-114
sp|Q54JM5|PSMD1_DICDI 26S proteasome non-ATPase regulatory subunit 1 OS=Dictyostelium discoideum GN=psmD1 PE=1 SV=1 1 438 2.0E-112
sp|P32565|RPN2_YEAST 26S proteasome regulatory subunit RPN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN2 PE=1 SV=4 2 403 4.0E-104
sp|Q18115|PSMD1_CAEEL 26S proteasome non-ATPase regulatory subunit 1 OS=Caenorhabditis elegans GN=rpn-2 PE=3 SV=4 2 438 2.0E-76
sp|Q8SSH5|RPN2_ENCCU 26S proteasome regulatory subunit RPN2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPN2 PE=1 SV=1 12 240 9.0E-33
sp|Q54JM5|PSMD1_DICDI 26S proteasome non-ATPase regulatory subunit 1 OS=Dictyostelium discoideum GN=psmD1 PE=1 SV=1 29 185 4.0E-10
sp|Q6FIP2|RPN2_CANGA 26S proteasome regulatory subunit RPN2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPN2 PE=3 SV=1 31 185 5.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup8099
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2887
Ophiocordyceps camponoti-rufipedis Ophun1|614 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|614
MYGRQKGADVMIEGLLNDPDPTLRYGGILTVAMAYCGSGSNKAIRKLLHTAVSDVNDDVRRIAVMSLGFILFRKP
GSVPRMVELLSESYNPHVRYGSAMALGISCAGTGLDEAIDLLEPMMKDPTDFVRQGALISLAMIMVQQNEVMNPK
VSSIRKTLKKVVGDRHEDAMTKFGAALALGIIDAGGRNCTIGLQTQTGNLNMAGIVGMAVFTQYWYWFPFTHFLS
LSFSPTAVIGLDHDLEMPDFKFHCAARQSLFDYPPEQEVKAEEAPSLIATAILSTTAQAKRRAQKKERAQRRESM
DLDQPPASAKSASADKMDVDDKKDEAKDKKASDDKETPTSADAKKKPEKEKIGYDIENLSRVLPGQLKYISFPAG
RYQPVKKPTGGPLLLDDTRPNEPKSLMEEKLKKATTERAPVAGQQPPSSSSTSGRPATTTRLSGRPLLEGLVDPS
RAAAGDSALEQLLRAQRRSPFGLADASHHQQQQQQQQQQSSISSSGAAAAAGVLTAVDEDGEGDEEAQVPREFEY
FSDEEAGQE*
Coding >Ophun1|614
ATGTACGGACGACAGAAGGGCGCCGACGTGATGATCGAGGGCCTGCTCAACGACCCGGACCCGACGCTCCGCTAC
GGCGGCATCCTCACCGTGGCCATGGCCTACTGCGGCAGCGGGAGCAATAAGGCGATCCGGAAGCTGCTGCACACG
GCCGTCAGCGACGTCAACGACGATGTCCGCCGCATCGCCGTCATGAGTCTCGGCTTCATCCTCTTCCGCAAGCCC
GGCAGCGTGCCGCGAATGGTTGAGCTGCTGTCCGAGTCGTACAACCCGCACGTCCGGTACGGATCGGCCATGGCG
CTCGGCATCTCTTGCGCCGGCACCGGTCTGGACGAGGCCATTGACCTGCTGGAGCCCATGATGAAGGACCCGACC
GACTTTGTCCGCCAGGGCGCCCTCATCTCGCTCGCCATGATCATGGTGCAGCAGAACGAGGTCATGAACCCGAAA
GTATCGTCGATCCGCAAGACGCTCAAGAAGGTGGTCGGCGATCGCCACGAAGACGCCATGACCAAGTTCGGCGCC
GCCCTCGCCCTCGGCATCATCGACGCCGGCGGCCGCAACTGCACCATCGGCCTGCAGACGCAGACGGGGAACCTT
AATATGGCGGGCATCGTGGGCATGGCAGTCTTCACCCAGTACTGGTACTGGTTCCCCTTTACCCACTTCCTCTCC
CTGAGCTTCTCGCCCACGGCCGTCATCGGCCTCGACCACGACCTCGAGATGCCCGACTTCAAGTTCCACTGCGCC
GCCCGCCAGAGCCTATTCGACTACCCGCCCGAGCAGGAGGTCAAGGCCGAGGAGGCGCCCTCGCTCATCGCCACC
GCCATCTTATCCACCACGGCGCAGGCCAAGCGGAGGGCCCAGAAGAAGGAGCGCGCCCAGCGTCGGGAGAGCATG
GACTTGGATCAGCCGCCGGCTTCGGCTAAGAGCGCGTCCGCGGATAAGATGGACGTGGACGACAAGAAGGACGAG
GCCAAGGACAAGAAGGCGTCGGATGACAAGGAGACGCCGACGTCGGCCGACGCCAAGAAGAAGCCGGAGAAGGAA
AAGATTGGTTACGACATTGAGAATCTGAGCCGTGTCTTGCCGGGCCAGCTCAAGTATATAAGCTTCCCGGCCGGC
CGCTACCAGCCGGTCAAGAAGCCAACCGGCGGCCCTCTCCTCCTCGACGACACGCGTCCCAACGAACCAAAGTCC
TTGATGGAAGAAAAGCTCAAAAAGGCAACGACAGAACGAGCCCCCGTCGCCGGCCAACAGCCTCCCTCGTCATCA
TCCACATCTGGCCGCCCCGCGACAACAACCCGTCTCAGCGGAAGGCCCCTCCTCGAAGGCCTCGTCGATCCCTCC
CGCGCCGCAGCCGGCGACTCGGCTCTCGAGCAGCTCCTCCGCGCCCAGCGTCGGTCTCCCTTTGGCCTCGCCGAC
GCCTCCCATCACCAGCAACAGCAGCAGCAGCAGCAGCAGCAATCTTCGATTTCTTCTTCCGGCGCTGCTGCGGCG
GCGGGCGTCCTCACGGCTGTGGATGAGGACGGGGAAGGGGATGAGGAGGCGCAGGTTCCGAGGGAGTTTGAGTAC
TTTTCTGACGAGGAAGCTGGTCAGGAATGA
Transcript >Ophun1|614
ATGTACGGACGACAGAAGGGCGCCGACGTGATGATCGAGGGCCTGCTCAACGACCCGGACCCGACGCTCCGCTAC
GGCGGCATCCTCACCGTGGCCATGGCCTACTGCGGCAGCGGGAGCAATAAGGCGATCCGGAAGCTGCTGCACACG
GCCGTCAGCGACGTCAACGACGATGTCCGCCGCATCGCCGTCATGAGTCTCGGCTTCATCCTCTTCCGCAAGCCC
GGCAGCGTGCCGCGAATGGTTGAGCTGCTGTCCGAGTCGTACAACCCGCACGTCCGGTACGGATCGGCCATGGCG
CTCGGCATCTCTTGCGCCGGCACCGGTCTGGACGAGGCCATTGACCTGCTGGAGCCCATGATGAAGGACCCGACC
GACTTTGTCCGCCAGGGCGCCCTCATCTCGCTCGCCATGATCATGGTGCAGCAGAACGAGGTCATGAACCCGAAA
GTATCGTCGATCCGCAAGACGCTCAAGAAGGTGGTCGGCGATCGCCACGAAGACGCCATGACCAAGTTCGGCGCC
GCCCTCGCCCTCGGCATCATCGACGCCGGCGGCCGCAACTGCACCATCGGCCTGCAGACGCAGACGGGGAACCTT
AATATGGCGGGCATCGTGGGCATGGCAGTCTTCACCCAGTACTGGTACTGGTTCCCCTTTACCCACTTCCTCTCC
CTGAGCTTCTCGCCCACGGCCGTCATCGGCCTCGACCACGACCTCGAGATGCCCGACTTCAAGTTCCACTGCGCC
GCCCGCCAGAGCCTATTCGACTACCCGCCCGAGCAGGAGGTCAAGGCCGAGGAGGCGCCCTCGCTCATCGCCACC
GCCATCTTATCCACCACGGCGCAGGCCAAGCGGAGGGCCCAGAAGAAGGAGCGCGCCCAGCGTCGGGAGAGCATG
GACTTGGATCAGCCGCCGGCTTCGGCTAAGAGCGCGTCCGCGGATAAGATGGACGTGGACGACAAGAAGGACGAG
GCCAAGGACAAGAAGGCGTCGGATGACAAGGAGACGCCGACGTCGGCCGACGCCAAGAAGAAGCCGGAGAAGGAA
AAGATTGGTTACGACATTGAGAATCTGAGCCGTGTCTTGCCGGGCCAGCTCAAGTATATAAGCTTCCCGGCCGGC
CGCTACCAGCCGGTCAAGAAGCCAACCGGCGGCCCTCTCCTCCTCGACGACACGCGTCCCAACGAACCAAAGTCC
TTGATGGAAGAAAAGCTCAAAAAGGCAACGACAGAACGAGCCCCCGTCGCCGGCCAACAGCCTCCCTCGTCATCA
TCCACATCTGGCCGCCCCGCGACAACAACCCGTCTCAGCGGAAGGCCCCTCCTCGAAGGCCTCGTCGATCCCTCC
CGCGCCGCAGCCGGCGACTCGGCTCTCGAGCAGCTCCTCCGCGCCCAGCGTCGGTCTCCCTTTGGCCTCGCCGAC
GCCTCCCATCACCAGCAACAGCAGCAGCAGCAGCAGCAGCAATCTTCGATTTCTTCTTCCGGCGCTGCTGCGGCG
GCGGGCGTCCTCACGGCTGTGGATGAGGACGGGGAAGGGGATGAGGAGGCGCAGGTTCCGAGGGAGTTTGAGTAC
TTTTCTGACGAGGAAGCTGGTCAGGAATGA
Gene >Ophun1|614
ATGTACGGACGACAGAAGGGCGCCGACGTGATGATCGAGGGCCTGCTCAACGACCCGGACCCGACGCTCCGCTAC
GGCGGCATCCTCACCGTGGCCATGGCCTACTGCGGCAGCGGGAGCAATAAGGCGATCCGGAAGCTGCTGCACACG
GCCGTCAGCGACGTCAACGACGATGTCCGCCGCATCGCCGTCATGAGTCTCGGCTTCATCCTCTTCCGCAAGCCC
GGCAGCGTGCCGCGAATGGTTGAGCTGCTGTCCGAGTCGTACAACCCGCACGTCCGGTACGGATCGGCCATGGCG
CTCGGCATCTCTTGCGCCGGCACCGGTCTGGACGAGGCCATTGACCTGCTGGAGCCCATGATGAAGGACCCGACC
GACTTTGTCCGCCAGGGCGCCCTCATCTCGCTCGCCATGATCATGGTGCAGCAGAACGAGGTCATGAACCCGAAA
GTATCGTCGATCCGCAAGACGCTCAAGAAGGTGGTCGGCGATCGCCACGAAGACGCCATGACCAAGTTCGGCGCC
GCCCTCGCCCTCGGCATCATCGACGCCGGCGGCCGCAACTGCACCATCGGCCTGCAGACGCAGACGGGGAACCTT
AATATGGCGGGCATCGTGGGCATGGCAGTCTTCACCCAGTACTGGTACTGGTTCCCCTTTACCCACTTCCTCTCC
CTGAGCTTCTCGCCCACGGCCGTCATCGGCCTCGACCACGACCTCGAGATGCCCGACTTCAAGTTCCACTGCGCC
GCCCGCCAGAGCCTATTCGACTACCCGCCCGAGCAGGAGGTCAAGGCCGAGGAGGCGCCCTCGCTCATCGCCACC
GCCATCTTATCCACCACGGCGCAGGCCAAGCGGAGGGCCCAGAAGAAGGAGCGCGCCCAGCGTCGGGAGAGCATG
GACTTGGATCAGCCGCCGGCTTCGGCTAAGAGCGCGTCCGCGGATAAGATGGACGTGGACGACAAGAAGGACGAG
GCCAAGGACAAGAAGGCGTCGGATGACAAGGAGACGCCGACGTCGGCCGACGCCAAGAAGAAGCCGGAGAAGGAA
AAGATTGGTTACGACATTGAGAATCTGAGCCGTGTCTTGCCGGGCCAGCTCAAGTATATAAGCTTCCCGGCCGGC
CGCTACCAGCCGGTCAAGAAGGTGAGCCAGTCTCGGTTTTCTCCTCCTCTAGGAGAAGAAGAAGAAGAAGAAATA
GCTGACATCTCCTCACAGCCAACCGGCGGCCCTCTCCTCCTCGACGACACGCGTCCCAACGAACCAAAGTCCTTG
ATGGAAGAAAAGCTCAAAAAGGCAACGACAGAACGAGCCCCCGTCGCCGGCCAACAGCCTCCCTCGTCATCATCC
ACATCTGGCCGCCCCGCGACAACAACCCGTCTCAGCGGAAGGCCCCTCCTCGAAGGCCTCGTCGATCCCTCCCGC
GCCGCAGCCGGCGACTCGGCTCTCGAGCAGCTCCTCCGCGCCCAGCGTCGGTCTCCCTTTGGCCTCGCCGACGCC
TCCCATCACCAGCAACAGCAGCAGCAGCAGCAGCAGCAATCTTCGATTTCTTCTTCCGGCGCTGCTGCGGCGGCG
GGCGTCCTCACGGCTGTGGATGAGGACGGGGAAGGGGATGAGGAGGCGCAGGTTCCGAGGGAGTTTGAGTACTTT
TCTGACGAGGAAGCTGGTCAGGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail