Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6135
Gene name
LocationContig_65:7434..8610
Strand-
Gene length (bp)1176
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q96JX3|SRAC1_HUMAN Protein SERAC1 OS=Homo sapiens GN=SERAC1 PE=1 SV=1 103 266 1.0E-06
sp|Q3U213|SRAC1_MOUSE Protein SERAC1 OS=Mus musculus GN=Serac1 PE=2 SV=1 103 266 3.0E-06
sp|Q5SNQ7|SRAC1_DANRE Protein SERAC1 OS=Danio rerio GN=serac1 PE=3 SV=1 103 253 4.0E-06
sp|Q2TBM9|SRAC1_BOVIN Protein SERAC1 OS=Bos taurus GN=SERAC1 PE=2 SV=1 103 258 4.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6135
MVTMNGLVQIGLMLLAGIAAVVYLFFKKLPNLRPEAKAKAKIETKVEKENLIDESTSEKQQKHEPADSEEDNRDW
SWMWKDGDKHVHWLRDSNMLPQVVERSRIIAYKYNSKWYSNAPKVRLQTCGEELVHQLHLFRKESPRRPLILIGH
SLGGNVILQALLFANDEDSYKYLTEATAGLVFLGTPFRGTKWQPFLNGLAHLFGLADSHDGITKELGFDEPLLAD
RLHRFCQLRNKLNIAVSCFSETLPTDYGRRHVVKGVASTDMPSTWIT*
Coding >Ophun1|6135
ATGGTAACAATGAATGGACTGGTGCAGATCGGGCTGATGCTCCTGGCTGGTATCGCCGCCGTCGTGTACCTGTTC
TTCAAGAAGCTGCCCAACTTGCGACCTGAGGCCAAAGCCAAAGCCAAGATCGAGACCAAAGTCGAGAAAGAGAAT
CTCATTGATGAGTCGACCTCGGAGAAACAGCAGAAGCACGAGCCTGCAGATAGTGAAGAAGACAATCGCGACTGG
TCCTGGATGTGGAAAGATGGCGACAAGCACGTCCACTGGCTTCGGGACTCCAATATGCTACCTCAAGTAGTTGAG
CGATCGAGAATCATTGCCTACAAGTACAACTCGAAATGGTACTCCAACGCCCCGAAGGTTCGTCTCCAGACCTGC
GGAGAGGAGCTCGTTCATCAGTTGCACTTGTTTCGAAAGGAAAGCCCCAGACGCCCACTTATTCTCATAGGTCAC
AGCCTTGGTGGGAACGTCATACTACAGGCCCTCCTCTTTGCCAATGACGAGGACTCATACAAGTACTTGACGGAG
GCGACTGCCGGCCTGGTGTTCCTAGGCACCCCTTTCCGGGGCACAAAATGGCAGCCCTTCCTTAATGGTCTTGCC
CACCTCTTCGGGCTGGCTGATTCACACGACGGAATCACTAAAGAGCTCGGCTTCGACGAGCCTCTGCTCGCGGAT
AGGCTACACCGGTTCTGCCAGCTGCGCAACAAATTAAACATCGCCGTCTCGTGTTTCAGTGAAACCTTGCCGACA
GACTATGGGCGTCGCCACGTGGTGAAAGGAGTGGCCTCGACAGACATGCCCTCGACGTGGATCACTTGA
Transcript >Ophun1|6135
ATGGTAACAATGAATGGACTGGTGCAGATCGGGCTGATGCTCCTGGCTGGTATCGCCGCCGTCGTGTACCTGTTC
TTCAAGAAGCTGCCCAACTTGCGACCTGAGGCCAAAGCCAAAGCCAAGATCGAGACCAAAGTCGAGAAAGAGAAT
CTCATTGATGAGTCGACCTCGGAGAAACAGCAGAAGCACGAGCCTGCAGATAGTGAAGAAGACAATCGCGACTGG
TCCTGGATGTGGAAAGATGGCGACAAGCACGTCCACTGGCTTCGGGACTCCAATATGCTACCTCAAGTAGTTGAG
CGATCGAGAATCATTGCCTACAAGTACAACTCGAAATGGTACTCCAACGCCCCGAAGGTTCGTCTCCAGACCTGC
GGAGAGGAGCTCGTTCATCAGTTGCACTTGTTTCGAAAGGAAAGCCCCAGACGCCCACTTATTCTCATAGGTCAC
AGCCTTGGTGGGAACGTCATACTACAGGCCCTCCTCTTTGCCAATGACGAGGACTCATACAAGTACTTGACGGAG
GCGACTGCCGGCCTGGTGTTCCTAGGCACCCCTTTCCGGGGCACAAAATGGCAGCCCTTCCTTAATGGTCTTGCC
CACCTCTTCGGGCTGGCTGATTCACACGACGGAATCACTAAAGAGCTCGGCTTCGACGAGCCTCTGCTCGCGGAT
AGGCTACACCGGTTCTGCCAGCTGCGCAACAAATTAAACATCGCCGTCTCGTGTTTCAGTGAAACCTTGCCGACA
GACTATGGGCGTCGCCACGTGGTGAAAGGAGTGGCCTCGACAGACATGCCCTCGACGTGGATCACTTGA
Gene >Ophun1|6135
ATGGTAACAATGAATGGACTGGTGCAGATCGGGCTGATGCTCCTGGCTGGTATCGCCGCCGTCGTGTACCTGTTC
TTCAAGAAGCTGCCCAACTTGCGACCTGAGGCCAAAGCCAAAGCCAAGATCGAGACCAAAGTCGAGAAAGAGAAT
CTCATTGATGAGTCGACCTCGGAGAAACAGCAGGTTTGTTGAGCCACCCAAAATAACACCAGTGTTCGATGAGAC
GCTGACAATGACTAGAAGCACGAGCCTGCAGATAGTGAAGAAGACAGTGAGCGCCAGGCTCTGAAGATTCTGTAC
CAATGCCCTGGAGCAGAGACTGACGAAACGGTTGTCGAGTAGGTTTAACTACCTATGAGATGAACCTCCATCTGA
TTAGTGCAGTATCGTCGCCGTACATGGCCTCGGTTCAGATCGCGACTGGTCCTGGATGTGGAAAGATGGCGACAA
GCACGTCCACTGGCTTCGGGACTCCAATATGCTACCTCAAGTAGTTGAGCGATCGAGAATCATTGCCTACAAGTA
CAACTCGAAATGGTACTCCAACGCCCCGAAGGTTCGTCTCCAGACCTGCGGAGAGGAGCTCGTTCATCAGTTGCA
CTTGTTTCGAAAGGAAAGCCCCAGACGCCCACTTATTCTCATAGGTCACAGCCTTGGTGGGAACGTCATACTACA
GGTGAGCATCTTTTATGTACGCTCCCTTGATATATCTTTCCTCACCTCCTACGTCTAGGCCCTCCTCTTTGCCAA
TGACGAGGACTCATACAAGTACTTGACGGAGGCGACTGCCGGCCTGGTGTTCCTAGGCACCCCTTTCCGGGGCAC
AAAATGGCAGCCCTTCCTTAATGGTCTTGCCCACCTCTTCGGGCTGGCTGATTCACACGACGGAATCACTAAAGA
GCTCGGCTTCGACGAGCCTCTGCTCGCGGATAGGCTACACCGGTTCTGCCAGCTGCGCAACAAATTAAACATCGC
CGTCTCGTGTTTCAGTGAAACCTTGCCGACAGACTATGGGCGTCGCCACGTGGTGAAAGGAGTGGTGAGAGGAAT
AGTATGTGAGAGCTATCATACGTTAACTCATACTGACATATGTTGACTTTCACACATAGGTCGTCGACGAGGCTT
CCGCTTGCATCCCAGGCCTCGACAGACATGCCCTCGACGTGGATCACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail