Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6132
Gene name
LocationContig_649:9569..9865
Strand-
Gene length (bp)296
Transcript length (bp)234
Coding sequence length (bp)234
Protein length (aa) 78

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4621
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2004
Ophiocordyceps australis map64 (Brazil) OphauB2|5453
Ophiocordyceps camponoti-floridani Ophcf2|04643
Ophiocordyceps camponoti-rufipedis Ophun1|6132 (this protein)
Ophiocordyceps kimflemingae Ophio5|6712
Ophiocordyceps subramaniannii Hirsu2|97

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6132
MCIVHLLRSEQPAANMWIEKQNFTASRHLWEAASSVDFYRAWREKPAYWVENSAFRDVWMYARPADLDEFTKVML
TP*
Coding >Ophun1|6132
ATGTGCATCGTTCACCTCTTGCGCTCGGAGCAGCCGGCGGCAAACATGTGGATCGAGAAGCAAAACTTCACAGCC
TCGCGCCACCTATGGGAAGCAGCCAGCTCAGTCGACTTCTACCGCGCCTGGCGGGAGAAGCCGGCCTACTGGGTT
GAGAACTCTGCCTTTCGCGACGTGTGGATGTATGCGAGGCCTGCCGACTTGGATGAGTTTACAAAGGTTATGCTT
ACGCCGTGA
Transcript >Ophun1|6132
ATGTGCATCGTTCACCTCTTGCGCTCGGAGCAGCCGGCGGCAAACATGTGGATCGAGAAGCAAAACTTCACAGCC
TCGCGCCACCTATGGGAAGCAGCCAGCTCAGTCGACTTCTACCGCGCCTGGCGGGAGAAGCCGGCCTACTGGGTT
GAGAACTCTGCCTTTCGCGACGTGTGGATGTATGCGAGGCCTGCCGACTTGGATGAGTTTACAAAGGTTATGCTT
ACGCCGTGA
Gene >Ophun1|6132
ATGTGCATCGTTCACCTCTTGCGCTCGGAGCAGCGTACGTGTCATCCCCTCAACCCCCTTCTCCGAACCAGCAGA
TCTGACCATGGGACATCCCAGCGGCGGCAAACATGTGGATCGAGAAGCAAAACTTCACAGCCTCGCGCCACCTAT
GGGAAGCAGCCAGCTCAGTCGACTTCTACCGCGCCTGGCGGGAGAAGCCGGCCTACTGGGTTGAGAACTCTGCCT
TTCGCGACGTGTGGATGTATGCGAGGCCTGCCGACTTGGATGAGTTTACAAAGGTTATGCTTACGCCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail