Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6129
Gene name
LocationContig_649:2495..5775
Strand-
Gene length (bp)3280
Transcript length (bp)2769
Coding sequence length (bp)2769
Protein length (aa) 923

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00856 SET SET domain 1.1E-07 568 618
PF01753 zf-MYND MYND finger 9.4E-08 436 474

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7XJS0|ASHR1_ARATH Histone-lysine N-methyltransferase ASHR1 OS=Arabidopsis thaliana GN=ASHR1 PE=2 SV=2 393 645 2.0E-25
sp|Q9CWR2|SMYD3_MOUSE Histone-lysine N-methyltransferase SMYD3 OS=Mus musculus GN=Smyd3 PE=2 SV=1 401 645 6.0E-22
sp|Q9H7B4|SMYD3_HUMAN Histone-lysine N-methyltransferase SMYD3 OS=Homo sapiens GN=SMYD3 PE=1 SV=4 401 645 5.0E-21
sp|O94256|SET6_SCHPO SET domain and MYND-type zinc finger protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set6 PE=3 SV=1 397 647 6.0E-20
sp|C3RZA1|SMYD2_PIG N-lysine methyltransferase SMYD2 OS=Sus scrofa GN=SMYD2 PE=2 SV=1 390 645 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7XJS0|ASHR1_ARATH Histone-lysine N-methyltransferase ASHR1 OS=Arabidopsis thaliana GN=ASHR1 PE=2 SV=2 393 645 2.0E-25
sp|Q9CWR2|SMYD3_MOUSE Histone-lysine N-methyltransferase SMYD3 OS=Mus musculus GN=Smyd3 PE=2 SV=1 401 645 6.0E-22
sp|Q9H7B4|SMYD3_HUMAN Histone-lysine N-methyltransferase SMYD3 OS=Homo sapiens GN=SMYD3 PE=1 SV=4 401 645 5.0E-21
sp|O94256|SET6_SCHPO SET domain and MYND-type zinc finger protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set6 PE=3 SV=1 397 647 6.0E-20
sp|C3RZA1|SMYD2_PIG N-lysine methyltransferase SMYD2 OS=Sus scrofa GN=SMYD2 PE=2 SV=1 390 645 2.0E-19
sp|Q9NRG4|SMYD2_HUMAN N-lysine methyltransferase SMYD2 OS=Homo sapiens GN=SMYD2 PE=1 SV=2 390 645 8.0E-19
sp|Q0P585|SMYD2_BOVIN N-lysine methyltransferase SMYD2 OS=Bos taurus GN=SMYD2 PE=2 SV=1 390 645 1.0E-18
sp|Q7ZXV5|SMY2A_XENLA N-lysine methyltransferase SMYD2-A OS=Xenopus laevis GN=smyd2-a PE=2 SV=1 394 645 3.0E-18
sp|Q99158|SIL1_YARLI Nucleotide exchange factor SIL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SIL1 PE=1 SV=2 30 295 3.0E-17
sp|Q5A360|SIL1_CANAL Nucleotide exchange factor SIL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SIL1 PE=3 SV=1 31 284 4.0E-17
sp|Q5RGL7|SMY2B_DANRE N-lysine methyltransferase SMYD2-B OS=Danio rerio GN=smyd2b PE=2 SV=2 398 645 5.0E-17
sp|Q6BTV5|SIL1_DEBHA Nucleotide exchange factor SIL1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SIL1 PE=3 SV=2 31 296 7.0E-17
sp|E1C5V0|SMYD2_CHICK N-lysine methyltransferase SMYD2 OS=Gallus gallus GN=SMYD2 PE=3 SV=1 392 664 1.0E-16
sp|Q6GN68|SMY2B_XENLA N-lysine methyltransferase SMYD2-B OS=Xenopus laevis GN=smyd2-b PE=2 SV=1 394 645 2.0E-15
sp|Q7M6Z3|SMYD2_RAT N-lysine methyltransferase SMYD2 OS=Rattus norvegicus GN=Smyd2 PE=1 SV=1 392 645 2.0E-15
sp|Q8R5A0|SMYD2_MOUSE N-lysine methyltransferase SMYD2 OS=Mus musculus GN=Smyd2 PE=1 SV=1 392 664 2.0E-15
sp|Q5BJI7|SMY2A_DANRE N-lysine methyltransferase SMYD2-A OS=Danio rerio GN=smyd2a PE=2 SV=1 398 645 1.0E-14
sp|Q54D67|Y2454_DICDI SET and MYND domain-containing protein DDB_G0292454 OS=Dictyostelium discoideum GN=DDB_G0292454 PE=3 SV=1 581 648 6.0E-09
sp|P38890|SET5_YEAST Putative protein lysine methyltransferase SET5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SET5 PE=1 SV=1 401 686 1.0E-08
sp|Q08199|SIL1_YEAST Nucleotide exchange factor SIL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIL1 PE=1 SV=1 42 227 3.0E-08
sp|Q758U2|SIL1_ASHGO Nucleotide exchange factor SIL1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SIL1 PE=3 SV=1 41 223 4.0E-08
sp|P83501|MSTAB_DROME Protein msta, isoform B OS=Drosophila melanogaster GN=msta PE=3 SV=2 398 646 3.0E-06
sp|Q9FPS9|UBP15_ARATH Ubiquitin carboxyl-terminal hydrolase 15 OS=Arabidopsis thaliana GN=UBP15 PE=2 SV=2 327 474 4.0E-06
sp|Q557F7|Y3589_DICDI SET and MYND domain-containing protein DDB_G0273589 OS=Dictyostelium discoideum GN=DDB_G0273589 PE=3 SV=1 547 649 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6129
MVGFRSRAVVVVSGLLAAVVASAPSRPHHSDVICHTSNSSDCYPRVFVPTHDFQIVHDDQDLPPGLHVRINIETH
KKEAKINVPGEHEAGALNGVVVKDVATSPESQDSALRIPKGAPAYDPVGKVKEPERDSGSFAAALTKLGDGSLAD
ESLDHIEELAHDIYYGLQLAENTEAVKTLLCLMVVVPSDSPSFTSRDHRAASILAGALSNNAAALSKVADAWPRL
AASNCSSNTDVSLGQSLISTLAPPPTTAGSMKEAASLAKAKMSVVNGLIKNADIRREFLNGGMMTKLLETLKLES
KDWADAQRKAGELVLDNFLDEDMGARLGQWPRVPRLSDEQCRTGSLAEGCWDYHVDAIMRANGAAPGHWSSVLHE
KLAAARGKMGAFGGGDGGRHEFPSLGRGLFALQPFTPGQTITTIDGPPLALPSTPALALICSNCLLPGKLRSCTG
CHAAWYCGGACQKSAWRTVHRRECGALARAEGGGKGRAARLPTPVRALVQALACPDVGRGLAALWGRRPDGDGLA
DVLVMARAACAFAGVDAGEAGMMRAVELLCKIQTNAFHRYDADMEHASVFLDPTLAMANHSCIPNALVHFVGRTA
ILTAERPIEAGHQVFISYTDYTCPLAKRREALSSYGFECGCHRCSEDLNVYQVCAAYPPPNTDASLIAPDVLSKL
SSHSAVVKRSARLLARTASETAVKAVESRVSADESPSGRRRMLLDQLRDCAELLAAGLWAVTPLPQVLTELSINY
AERGDSASALALACFVATTCDPYRYTAPSHPTRIRNLLVIAKLFANTAEGTAVSSQAVEPVEVRRKLDKRFRELF
RDLDQVSLCQILLIMVLQSAPTGRGAAWEPAVTARDMLRDIEQLPGRDQKLSIIAAWAQDPASDRSRMLFEHAVR
WPVDALAGLGRDILLVDLEADD*
Coding >Ophun1|6129
ATGGTCGGCTTCCGCTCTCGTGCCGTCGTCGTCGTCTCCGGCTTGCTGGCTGCTGTTGTGGCGTCGGCGCCTTCT
AGACCGCACCATTCCGACGTCATCTGCCATACCTCGAATAGCAGCGATTGCTATCCGCGCGTCTTTGTCCCGACG
CATGACTTTCAGATCGTTCACGATGACCAGGACTTGCCTCCGGGTCTGCATGTGCGCATCAATATTGAAACCCAC
AAGAAGGAGGCCAAGATCAACGTCCCTGGCGAGCACGAGGCCGGCGCTCTCAATGGCGTCGTCGTCAAGGATGTG
GCCACGTCGCCTGAAAGTCAAGACAGCGCGCTGCGTATCCCCAAGGGCGCGCCGGCTTACGACCCTGTCGGAAAG
GTCAAGGAGCCGGAGCGAGATTCCGGGTCGTTTGCCGCCGCCTTGACCAAGCTTGGCGATGGCTCTCTCGCCGAC
GAGTCTCTCGATCACATCGAGGAGCTGGCACACGACATCTACTATGGCCTCCAGCTGGCTGAGAATACAGAGGCC
GTTAAGACGCTCTTGTGTCTCATGGTCGTTGTTCCGTCAGATTCGCCCTCTTTCACCTCTCGTGACCATCGCGCC
GCCTCCATCCTCGCCGGCGCTCTTTCCAACAACGCGGCCGCCTTGAGCAAGGTGGCCGATGCCTGGCCACGCCTG
GCAGCGAGCAATTGTTCCTCCAACACCGACGTCTCGCTCGGTCAGTCCCTAATATCGACCCTCGCGCCACCGCCG
ACGACAGCCGGCTCGATGAAGGAAGCGGCTTCGCTCGCCAAGGCCAAGATGTCAGTCGTCAACGGTCTCATCAAG
AACGCCGACATCCGACGCGAATTCCTCAACGGCGGCATGATGACCAAGCTGCTGGAGACGCTCAAGCTCGAGAGC
AAAGACTGGGCCGACGCGCAGCGCAAAGCCGGCGAGCTGGTGCTCGACAATTTCCTGGACGAGGACATGGGCGCC
CGTCTCGGCCAGTGGCCAAGAGTCCCCCGGCTAAGCGACGAGCAGTGCCGGACGGGGTCTTTGGCAGAGGGCTGC
TGGGACTACCACGTCGACGCCATCATGCGGGCCAACGGGGCCGCGCCGGGGCATTGGAGTTCGGTGCTGCATGAG
AAGCTGGCGGCGGCGCGGGGGAAGATGGGCGCGTTTGGGGGCGGAGATGGAGGCCGGCATGAGTTCCCCTCCCTC
GGCCGCGGCCTATTCGCCCTCCAACCCTTCACCCCCGGCCAAACAATAACCACCATCGACGGACCCCCCCTCGCC
CTCCCATCCACGCCCGCCCTCGCCCTCATCTGCTCCAACTGCCTCCTCCCAGGCAAGCTGCGAAGCTGCACGGGC
TGCCACGCGGCCTGGTACTGCGGCGGGGCGTGCCAGAAATCCGCCTGGCGGACCGTCCACAGACGCGAGTGCGGC
GCTCTGGCGCGGGCGGAGGGGGGCGGCAAGGGACGGGCGGCGAGGTTGCCTACGCCTGTGCGGGCTCTTGTCCAG
GCGCTGGCTTGCCCGGATGTCGGCCGTGGGCTCGCGGCGCTTTGGGGGAGGAGGCCGGATGGTGATGGCTTGGCT
GACGTGCTGGTTATGGCGAGGGCGGCGTGTGCTTTTGCGGGGGTGGATGCCGGGGAGGCTGGGATGATGAGGGCT
GTTGAGCTGCTCTGCAAGATTCAAACGAATGCTTTCCACAGGTATGATGCCGACATGGAACACGCGAGCGTCTTC
CTTGATCCGACGCTGGCCATGGCGAATCACTCGTGCATTCCCAATGCTCTGGTTCACTTTGTTGGTCGCACCGCC
ATCTTGACGGCAGAGCGGCCCATCGAAGCTGGCCATCAGGTCTTCATCTCTTACACGGACTACACTTGCCCCCTC
GCCAAGAGGAGAGAGGCTCTATCGTCCTATGGCTTCGAGTGCGGCTGTCACCGCTGTAGCGAGGACCTCAACGTC
TACCAAGTCTGCGCCGCCTACCCTCCGCCAAACACAGACGCCAGCCTGATCGCCCCCGACGTCTTGTCCAAGCTC
AGCAGCCACTCAGCCGTCGTCAAGCGGTCCGCGCGCCTTCTGGCGAGAACCGCTAGCGAAACCGCCGTCAAGGCC
GTCGAATCCCGCGTCTCCGCCGATGAGAGTCCTTCGGGACGTCGTCGGATGCTGCTCGATCAATTGCGCGACTGC
GCCGAGTTACTAGCCGCAGGACTCTGGGCAGTGACTCCCTTGCCCCAGGTATTGACCGAGCTATCCATCAATTAT
GCCGAGCGCGGCGACTCGGCCTCGGCGCTGGCGCTGGCCTGCTTCGTCGCAACGACCTGCGACCCCTATCGGTAC
ACGGCGCCCTCTCATCCGACCAGGATCAGGAACCTTCTCGTCATCGCCAAGTTATTTGCAAATACGGCAGAGGGG
ACGGCTGTCTCGAGTCAGGCCGTAGAGCCCGTCGAGGTCCGTCGCAAACTCGACAAGAGGTTCCGAGAGTTATTT
CGCGATCTCGACCAGGTCTCGCTATGCCAGATACTGCTTATCATGGTGTTGCAATCAGCCCCAACCGGTCGCGGC
GCAGCCTGGGAGCCCGCCGTGACGGCGCGAGATATGCTACGGGACATCGAGCAGCTGCCTGGTCGGGACCAGAAA
TTGTCCATCATCGCCGCCTGGGCGCAAGACCCTGCCAGCGACCGATCTCGGATGTTGTTCGAACACGCCGTGAGG
TGGCCCGTGGATGCCTTGGCCGGTCTGGGACGTGACATACTCCTCGTCGACCTGGAAGCCGACGACTGA
Transcript >Ophun1|6129
ATGGTCGGCTTCCGCTCTCGTGCCGTCGTCGTCGTCTCCGGCTTGCTGGCTGCTGTTGTGGCGTCGGCGCCTTCT
AGACCGCACCATTCCGACGTCATCTGCCATACCTCGAATAGCAGCGATTGCTATCCGCGCGTCTTTGTCCCGACG
CATGACTTTCAGATCGTTCACGATGACCAGGACTTGCCTCCGGGTCTGCATGTGCGCATCAATATTGAAACCCAC
AAGAAGGAGGCCAAGATCAACGTCCCTGGCGAGCACGAGGCCGGCGCTCTCAATGGCGTCGTCGTCAAGGATGTG
GCCACGTCGCCTGAAAGTCAAGACAGCGCGCTGCGTATCCCCAAGGGCGCGCCGGCTTACGACCCTGTCGGAAAG
GTCAAGGAGCCGGAGCGAGATTCCGGGTCGTTTGCCGCCGCCTTGACCAAGCTTGGCGATGGCTCTCTCGCCGAC
GAGTCTCTCGATCACATCGAGGAGCTGGCACACGACATCTACTATGGCCTCCAGCTGGCTGAGAATACAGAGGCC
GTTAAGACGCTCTTGTGTCTCATGGTCGTTGTTCCGTCAGATTCGCCCTCTTTCACCTCTCGTGACCATCGCGCC
GCCTCCATCCTCGCCGGCGCTCTTTCCAACAACGCGGCCGCCTTGAGCAAGGTGGCCGATGCCTGGCCACGCCTG
GCAGCGAGCAATTGTTCCTCCAACACCGACGTCTCGCTCGGTCAGTCCCTAATATCGACCCTCGCGCCACCGCCG
ACGACAGCCGGCTCGATGAAGGAAGCGGCTTCGCTCGCCAAGGCCAAGATGTCAGTCGTCAACGGTCTCATCAAG
AACGCCGACATCCGACGCGAATTCCTCAACGGCGGCATGATGACCAAGCTGCTGGAGACGCTCAAGCTCGAGAGC
AAAGACTGGGCCGACGCGCAGCGCAAAGCCGGCGAGCTGGTGCTCGACAATTTCCTGGACGAGGACATGGGCGCC
CGTCTCGGCCAGTGGCCAAGAGTCCCCCGGCTAAGCGACGAGCAGTGCCGGACGGGGTCTTTGGCAGAGGGCTGC
TGGGACTACCACGTCGACGCCATCATGCGGGCCAACGGGGCCGCGCCGGGGCATTGGAGTTCGGTGCTGCATGAG
AAGCTGGCGGCGGCGCGGGGGAAGATGGGCGCGTTTGGGGGCGGAGATGGAGGCCGGCATGAGTTCCCCTCCCTC
GGCCGCGGCCTATTCGCCCTCCAACCCTTCACCCCCGGCCAAACAATAACCACCATCGACGGACCCCCCCTCGCC
CTCCCATCCACGCCCGCCCTCGCCCTCATCTGCTCCAACTGCCTCCTCCCAGGCAAGCTGCGAAGCTGCACGGGC
TGCCACGCGGCCTGGTACTGCGGCGGGGCGTGCCAGAAATCCGCCTGGCGGACCGTCCACAGACGCGAGTGCGGC
GCTCTGGCGCGGGCGGAGGGGGGCGGCAAGGGACGGGCGGCGAGGTTGCCTACGCCTGTGCGGGCTCTTGTCCAG
GCGCTGGCTTGCCCGGATGTCGGCCGTGGGCTCGCGGCGCTTTGGGGGAGGAGGCCGGATGGTGATGGCTTGGCT
GACGTGCTGGTTATGGCGAGGGCGGCGTGTGCTTTTGCGGGGGTGGATGCCGGGGAGGCTGGGATGATGAGGGCT
GTTGAGCTGCTCTGCAAGATTCAAACGAATGCTTTCCACAGGTATGATGCCGACATGGAACACGCGAGCGTCTTC
CTTGATCCGACGCTGGCCATGGCGAATCACTCGTGCATTCCCAATGCTCTGGTTCACTTTGTTGGTCGCACCGCC
ATCTTGACGGCAGAGCGGCCCATCGAAGCTGGCCATCAGGTCTTCATCTCTTACACGGACTACACTTGCCCCCTC
GCCAAGAGGAGAGAGGCTCTATCGTCCTATGGCTTCGAGTGCGGCTGTCACCGCTGTAGCGAGGACCTCAACGTC
TACCAAGTCTGCGCCGCCTACCCTCCGCCAAACACAGACGCCAGCCTGATCGCCCCCGACGTCTTGTCCAAGCTC
AGCAGCCACTCAGCCGTCGTCAAGCGGTCCGCGCGCCTTCTGGCGAGAACCGCTAGCGAAACCGCCGTCAAGGCC
GTCGAATCCCGCGTCTCCGCCGATGAGAGTCCTTCGGGACGTCGTCGGATGCTGCTCGATCAATTGCGCGACTGC
GCCGAGTTACTAGCCGCAGGACTCTGGGCAGTGACTCCCTTGCCCCAGGTATTGACCGAGCTATCCATCAATTAT
GCCGAGCGCGGCGACTCGGCCTCGGCGCTGGCGCTGGCCTGCTTCGTCGCAACGACCTGCGACCCCTATCGGTAC
ACGGCGCCCTCTCATCCGACCAGGATCAGGAACCTTCTCGTCATCGCCAAGTTATTTGCAAATACGGCAGAGGGG
ACGGCTGTCTCGAGTCAGGCCGTAGAGCCCGTCGAGGTCCGTCGCAAACTCGACAAGAGGTTCCGAGAGTTATTT
CGCGATCTCGACCAGGTCTCGCTATGCCAGATACTGCTTATCATGGTGTTGCAATCAGCCCCAACCGGTCGCGGC
GCAGCCTGGGAGCCCGCCGTGACGGCGCGAGATATGCTACGGGACATCGAGCAGCTGCCTGGTCGGGACCAGAAA
TTGTCCATCATCGCCGCCTGGGCGCAAGACCCTGCCAGCGACCGATCTCGGATGTTGTTCGAACACGCCGTGAGG
TGGCCCGTGGATGCCTTGGCCGGTCTGGGACGTGACATACTCCTCGTCGACCTGGAAGCCGACGACTGA
Gene >Ophun1|6129
ATGGTCGGCTTCCGCTCTCGTGCCGTCGTCGTCGTCTCCGGCTTGCTGGCTGCTGTTGTGGCGTCGGCGCCTTCT
AGACCGCACCATTCCGACGTCATCTGCCATACCTCGAATAGCAGCGATTGCTATCCGCGCGTCTTTGTCCCGACG
CATGACTTTCAGATCGTTCACGATGACCAGGACTTGCCTCCGGGTCTGCATGTGCGCATCAATATTGAAACCCAC
AAGAAGGAGGCCAAGATCAACGTCCCTGGCGAGCACGAGGCCGGCGCTCTCAATGGCGTCGTCGTCAAGGATGTG
GCCACGTCGCCTGAAAGTCAAGACAGCGCGCTGCGTATCCCCAAGGGCGCGCCGGCTTACGACCCTGTCGGAAAG
GTCAAGGAGCCGGAGCGAGATTCCGGGTCGTTTGCCGCCGCCTTGACCAAGCTTGGCGATGGCTCTCTCGCCGAC
GAGTCTCTCGATCACATCGAGGAGCTGGCACACGACATCTACTATGGCCTCCAGCTGGCTGAGAATACAGAGGCC
GTTAAGACGCTCTTGTGTCTCATGGTCGTTGTTCCGTCAGATTCGCCCTCTTTCACCTCTCGTGACCATCGCGCC
GCCTCCATCCTCGCCGGCGCTCTTTCCAACAACGCGGCCGCCTTGAGCAAGGTGGCCGATGCCTGGCCACGCCTG
GCAGCGAGCAATTGTTCCTCCAACACCGACGTCTCGCTCGGTCAGTCCCTAATATCGACCCTCGCGCCACCGCCG
ACGACAGCCGGCTCGATGAAGGAAGCGGCTTCGCTCGCCAAGGCCAAGATGTCAGTCGTCAACGGTCTCATCAAG
AACGCCGACATCCGACGCGAATTCCTCAACGGCGGCATGATGACCAAGCTGCTGGAGACGCTCAAGCTCGAGAGC
AAAGACTGGGCCGACGCGCAGCGCAAAGCCGGCGAGCTGGTGCTCGACAATTTCCTGGACGAGGACATGGGCGCC
CGTCTCGGCCAGTGGCCAAGAGTCCCCCGGCTAAGCGACGAGCAGTGCCGGACGGGGTCTTTGGCAGAGGGCTGC
TGGGACTACCACGTCGACGCCATCATGCGGGCCAACGGGGCCGCGCCGGGGCATTGGAGTTCGGTGCTGCATGAG
AAGCTGGCGGCGGCGCGGGGGAAGATGGGCGCGTTTGGGGGCGGAGATGGAGGCCGGCATGAGTTGTGAGAGGGG
AGCTTGTCTTTGGTGTTTGGATCAGCATGGTGGTGTTCCGGTATCTGACTTGGCGGTAGATTTTAGAATGGGATG
TAGGAATATCATTGGCGTCGGCGGGAATATCCCTGAGATGCCTCTGTAACGGCATGTTTCATCTCGCTCTATCAA
GCTGGTTAGCTGAGCCCGCACTCTGGAGACTCGAAGCCGTCATCGGAGCGTCATCGGAGCGTCATCGGAGGCTAT
ACAGACAGCCTCCTGCGAGAGCTGCGGGTCACGTGTCTATCAAGACTCATCCGCCCATATCCATCACAACCTTCT
CACCACCCAAACATCCCCTCTAAACAACAACAACCAAACCCTACCATGGACCCCCCCCCCTCGGAAACCCTCCAA
ATCCGCCAAGCCAGCCCCTCCCTCGGCCGCGGCCTATTCGCCCTCCAACCCTTCACCCCCGGCCAAACAATAACC
ACCATCGACGGACCCCCCCTCGCCCTCCCATCCACGCCCGCCCTCGCCCTCATCTGCTCCAACTGCCTCCTCCCA
GGCAAGCTGCGAAGCTGCACGGGCTGCCACGCGGCCTGGTACTGCGGCGGGGCGTGCCAGAAATCCGCCTGGCGG
ACCGTCCACAGACGCGAGTGCGGCGCTCTGGCGCGGGCGGAGGGGGGCGGCAAGGGACGGGCGGCGAGGTTGCCT
ACGCCTGTGCGGGCTCTTGTCCAGGCGCTGGCTTGCCCGGATGTCGGCCGTGGGCTCGCGGCGCTTTGGGGGAGG
AGGCCGGATGGTGATGGCTTGGCTGACGTGCTGGTTATGGCGAGGGCGGCGTGTGCTTTTGCGGGGGTGGATGCC
GGGGAGGCTGGGATGATGAGGGCTGTTGAGCTGCTCTGCAAGGTTTGTCTTGTTCTTCTCGGTCGTGGGGGTGGT
TGTGCTTTGTTGGCTGACTGGGGCAGATTCAAACGAATGCTTTCCACAGGTATGATGCCGACATGGAACACGCGA
GCGTCTTCCTTGATCCGACGCTGGCCATGGCGAATCACTCGTGCATTCCCAATGCTCTGGTTCACTTTGTTGGTC
GCACCGCCATCTTGACGGCAGAGCGGCCCATCGAAGCTGGCCATCAGGTCTTCATCTCTTACACGGGTCAGTCCG
TCCAGCCCTCTCCGGCCTGGCGAATGTCCGGTAACTCGACCTAGACTACACTTGCCCCCTCGCCAAGAGGAGAGA
GGCTCTATCGTCCTATGGCTTCGAGTGCGGCTGTCACCGCTGTAGCGAGGACCTCAACGTCTACCAAGTCTGCGC
CGCCTACCCTCCGCCAAACACAGACGCCAGCCTGATCGCCCCCGACGTCTTGTCCAAGCTCAGCAGCCACTCAGC
CGTCGTCAAGCGGTCCGCGCGCCTTCTGGCGAGAACCGCTAGCGAAACCGCCGTCAAGGCCGTCGAATCCCGCGT
CTCCGCCGATGAGAGTCCTTCGGGACGTCGTCGGATGCTGCTCGATCAATTGCGCGACTGCGCCGAGTTACTAGC
CGCAGGACTCTGGGCAGTGACTCCCTTGCCCCAGGTATTGACCGAGCTATCCATCAATTATGCCGAGCGCGGCGA
CTCGGCCTCGGCGCTGGCGCTGGCCTGCTTCGTCGCAACGACCTGCGACCCCTATCGGTACACGGCGCCCTCTCA
TCCGACCAGGATCAGGAACCTTCTCGTCATCGCCAAGTTATTTGCAAATACGGCAGAGGGGACGGCTGTCTCGAG
TCAGGCCGTAGAGCCCGTCGAGGTCCGTCGCAAACTCGACAAGAGGTTCCGAGAGTTATTTCGCGATCTCGACCA
GGTCTCGCTATGCCAGATACTGCTTATCATGGTGTTGCAATCAGCCCCAACCGGTCGCGGCGCAGCCTGGGAGCC
CGCCGTGACGGCGCGAGATATGCTACGGGACATCGAGCAGCTGCCTGGTCGGGACCAGAAATTGTCCATCATCGC
CGCCTGGGCGCAAGACCCTGCCAGCGACCGATCTCGGATGTTGTTCGAACACGCCGTGAGGTGGCCCGTGGATGC
CTTGGCCGGTCTGGGACGTGACATACTCCTCGTCGACCTGGAAGCCGACGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail