Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6125
Gene name
LocationContig_648:5769..7389
Strand+
Gene length (bp)1620
Transcript length (bp)1458
Coding sequence length (bp)1458
Protein length (aa) 486

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00285 Citrate_synt Citrate synthase, C-terminal domain 4.9E-95 73 471

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34085|CISY_NEUCR Citrate synthase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cit-1 PE=2 SV=2 1 485 0.0E+00
sp|O00098|CISY_EMENI Citrate synthase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=citA PE=2 SV=3 1 482 0.0E+00
sp|P51044|CISY_ASPNG Citrate synthase, mitochondrial OS=Aspergillus niger GN=cit-1 PE=2 SV=1 1 476 0.0E+00
sp|Q6C793|PRPC_YARLI 2-methylcitrate synthase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E02684g PE=1 SV=1 1 482 0.0E+00
sp|Q10306|CISY_SCHPO Probable citrate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cit1 PE=3 SV=3 1 476 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34085|CISY_NEUCR Citrate synthase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cit-1 PE=2 SV=2 1 485 0.0E+00
sp|O00098|CISY_EMENI Citrate synthase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=citA PE=2 SV=3 1 482 0.0E+00
sp|P51044|CISY_ASPNG Citrate synthase, mitochondrial OS=Aspergillus niger GN=cit-1 PE=2 SV=1 1 476 0.0E+00
sp|Q6C793|PRPC_YARLI 2-methylcitrate synthase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E02684g PE=1 SV=1 1 482 0.0E+00
sp|Q10306|CISY_SCHPO Probable citrate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cit1 PE=3 SV=3 1 476 0.0E+00
sp|P00890|CISY1_YEAST Citrate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIT1 PE=1 SV=2 20 485 0.0E+00
sp|P79024|CISY_CANTR Citrate synthase, mitochondrial OS=Candida tropicalis GN=CIT PE=3 SV=1 1 485 0.0E+00
sp|P08679|CISY2_YEAST Citrate synthase, peroxisomal OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIT2 PE=1 SV=1 25 485 0.0E+00
sp|Q6S9V7|CISY_KATPE Citrate synthase, mitochondrial OS=Katsuwonus pelamis GN=cs PE=2 SV=1 3 476 0.0E+00
sp|Q6S9V8|CISY_THUOB Citrate synthase, mitochondrial OS=Thunnus obesus GN=cs PE=2 SV=1 3 476 0.0E+00
sp|Q6S9V9|CISY_THUAL Citrate synthase, mitochondrial OS=Thunnus albacares GN=cs PE=2 SV=1 3 476 0.0E+00
sp|Q6S9V6|CISY_XIPGL Citrate synthase, mitochondrial OS=Xiphias gladius GN=cs PE=2 SV=1 3 476 0.0E+00
sp|Q6S9V5|CISY_KAJAU Citrate synthase, mitochondrial OS=Kajikia audax GN=cs PE=2 SV=1 3 476 0.0E+00
sp|Q7ZVY5|CISY_DANRE Citrate synthase, mitochondrial OS=Danio rerio GN=cs PE=2 SV=1 3 476 0.0E+00
sp|Q29RK1|CISY_BOVIN Citrate synthase, mitochondrial OS=Bos taurus GN=CS PE=1 SV=1 24 476 0.0E+00
sp|P0C1Z2|CISY_MACFA Citrate synthase, mitochondrial OS=Macaca fascicularis GN=CS PE=2 SV=1 24 476 0.0E+00
sp|Q4S5X1|CISY_TETNG Citrate synthase, mitochondrial OS=Tetraodon nigroviridis GN=cs PE=3 SV=1 3 482 0.0E+00
sp|P00889|CISY_PIG Citrate synthase, mitochondrial OS=Sus scrofa GN=CS PE=1 SV=2 24 482 0.0E+00
sp|Q0GNE1|CISY_AMBCR Citrate synthase, mitochondrial OS=Amblyrhynchus cristatus GN=CS PE=2 SV=1 1 476 0.0E+00
sp|Q7ZWZ5|CISY_XENLA Citrate synthase, mitochondrial OS=Xenopus laevis GN=cs PE=2 SV=1 3 482 0.0E+00
sp|O75390|CISY_HUMAN Citrate synthase, mitochondrial OS=Homo sapiens GN=CS PE=1 SV=2 24 476 0.0E+00
sp|Q0GNE0|CISY_IGUIG Citrate synthase, mitochondrial OS=Iguana iguana GN=CS PE=2 SV=1 1 476 0.0E+00
sp|Q9CZU6|CISY_MOUSE Citrate synthase, mitochondrial OS=Mus musculus GN=Cs PE=1 SV=1 24 476 0.0E+00
sp|Q28DK1|CISY_XENTR Citrate synthase, mitochondrial OS=Xenopus tropicalis GN=cs PE=2 SV=1 29 482 0.0E+00
sp|Q8VHF5|CISY_RAT Citrate synthase, mitochondrial OS=Rattus norvegicus GN=Cs PE=1 SV=1 24 476 0.0E+00
sp|Q9W401|CISY_DROME Probable citrate synthase, mitochondrial OS=Drosophila melanogaster GN=kdn PE=2 SV=1 25 484 0.0E+00
sp|Q16P20|CISY2_AEDAE Probable citrate synthase 2, mitochondrial OS=Aedes aegypti GN=AAEL011789 PE=3 SV=1 29 476 0.0E+00
sp|Q17GM7|CISY1_AEDAE Probable citrate synthase 1, mitochondrial OS=Aedes aegypti GN=AAEL002956 PE=3 SV=1 29 476 0.0E+00
sp|Q0QHL3|CISY_GLOMM Probable citrate synthase, mitochondrial OS=Glossina morsitans morsitans PE=2 SV=1 25 484 0.0E+00
sp|P23007|CISY_CHICK Citrate synthase, mitochondrial OS=Gallus gallus GN=CS PE=1 SV=1 30 481 0.0E+00
sp|Q553V1|CISYM_DICDI Citrate synthase, mitochondrial OS=Dictyostelium discoideum GN=cs PE=3 SV=1 23 479 0.0E+00
sp|P34575|CISY_CAEEL Probable citrate synthase, mitochondrial OS=Caenorhabditis elegans GN=cts-1 PE=3 SV=1 32 482 6.0E-179
sp|O80433|CISY_DAUCA Citrate synthase, mitochondrial OS=Daucus carota GN=CS PE=2 SV=1 23 484 3.0E-177
sp|Q61JF9|CISY_CAEBR Probable citrate synthase, mitochondrial OS=Caenorhabditis briggsae GN=cts-1 PE=3 SV=1 32 482 5.0E-177
sp|C7C436|PRPC_GIBMO 2-methylcitrate synthase, mitochondrial OS=Gibberella moniliformis GN=mcsA PE=1 SV=1 20 476 2.0E-175
sp|P20115|CISY4_ARATH Citrate synthase 4, mitochondrial OS=Arabidopsis thaliana GN=CSY4 PE=1 SV=3 15 484 1.0E-174
sp|C7C435|PRPC_NECHA 2-methylcitrate synthase, mitochondrial OS=Nectria haematococca GN=mcsA PE=1 SV=1 20 476 9.0E-172
sp|Q9M1D3|CISY5_ARATH Citrate synthase 5, mitochondrial OS=Arabidopsis thaliana GN=CSY5 PE=3 SV=2 12 485 5.0E-171
sp|P49298|CISY_CITMA Citrate synthase, mitochondrial OS=Citrus maxima GN=CIT PE=2 SV=1 12 484 2.0E-169
sp|Q4QDX3|CISY_LEIMA Probable citrate synthase, mitochondrial OS=Leishmania major GN=LmjF18.0680 PE=3 SV=1 25 476 6.0E-163
sp|P83372|CISY_FRAAN Citrate synthase, mitochondrial OS=Fragaria ananassa GN=MCSI PE=1 SV=1 12 484 2.0E-162
sp|A4HXU4|CISY_LEIIN Probable citrate synthase, mitochondrial OS=Leishmania infantum GN=LinJ18.0690 PE=3 SV=1 25 476 2.0E-160
sp|Q50I20|PRPC_ASPFM 2-methylcitrate synthase, mitochondrial OS=Neosartorya fumigata GN=mcsA PE=1 SV=1 1 472 4.0E-160
sp|B0YD89|PRPC_ASPFC 2-methylcitrate synthase, mitochondrial OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mcsA PE=1 SV=1 1 472 4.0E-160
sp|Q9TEM3|PRPC_EMENI 2-methylcitrate synthase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mcsA PE=1 SV=1 16 472 3.0E-158
sp|A4H9H8|CISY_LEIBR Probable citrate synthase, mitochondrial OS=Leishmania braziliensis GN=LbrM18_V2.0760 PE=3 SV=1 25 476 1.0E-153
sp|Q43175|CISY_SOLTU Citrate synthase, mitochondrial OS=Solanum tuberosum PE=2 SV=1 3 484 2.0E-152
sp|P24118|CISY_TETTH Citrate synthase, mitochondrial OS=Tetrahymena thermophila PE=1 SV=1 12 480 2.0E-142
sp|P43635|CISY3_YEAST Citrate synthase 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIT3 PE=1 SV=1 21 476 5.0E-133
sp|Q0QEL7|CISY_MESAU Citrate synthase, mitochondrial (Fragment) OS=Mesocricetus auratus GN=CS PE=1 SV=1 231 461 5.0E-102
sp|Q9SJH7|CISY3_ARATH Citrate synthase 3, peroxisomal OS=Arabidopsis thaliana GN=CSY3 PE=2 SV=1 85 479 2.0E-24
sp|P20901|CISY_ACEAC Citrate synthase OS=Acetobacter aceti GN=aarA PE=1 SV=1 119 456 2.0E-24
sp|Q9LXS6|CISY2_ARATH Citrate synthase 2, peroxisomal OS=Arabidopsis thaliana GN=CSY2 PE=2 SV=1 87 454 3.0E-24
sp|P42457|CISY_CORGL Citrate synthase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=gltA PE=3 SV=1 85 475 5.0E-24
sp|P9WPD5|CISY1_MYCTU Citrate synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gltA2 PE=1 SV=1 85 452 1.0E-23
sp|P9WPD4|CISY1_MYCTO Citrate synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gltA2 PE=3 SV=1 85 452 1.0E-23
sp|Q59977|CISY_SYNY3 Citrate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gltA PE=3 SV=1 73 452 7.0E-23
sp|P20902|CISY_ACIAN Citrate synthase OS=Acinetobacter calcoaceticus subsp. anitratus GN=gltA PE=3 SV=2 123 475 7.0E-23
sp|P49299|CYSZ_CUCMA Citrate synthase, glyoxysomal OS=Cucurbita maxima PE=1 SV=1 85 479 3.0E-22
sp|O33915|CISY_RHIME Citrate synthase OS=Rhizobium meliloti (strain 1021) GN=gltA PE=3 SV=2 123 456 3.0E-22
sp|P51037|CISY1_RHITR Citrate synthase, chromosomal OS=Rhizobium tropici GN=ccsA PE=3 SV=2 123 456 8.0E-22
sp|P51038|CISY2_RHITR Citrate synthase, plasmid OS=Rhizobium tropici GN=pcsA PE=3 SV=1 123 456 8.0E-22
sp|Q59734|CISY_RICBE Citrate synthase (Fragment) OS=Rickettsia bellii GN=gltA PE=3 SV=1 38 456 4.0E-21
sp|P94325|CISY_BRADU Citrate synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gltA PE=3 SV=2 123 456 7.0E-21
sp|Q1RGV8|CISY_RICBR Citrate synthase OS=Rickettsia bellii (strain RML369-C) GN=gltA PE=3 SV=1 38 456 8.0E-21
sp|Q59741|CISY_RICHE Citrate synthase (Fragment) OS=Rickettsia helvetica GN=gltA PE=3 SV=1 123 456 9.0E-21
sp|P18789|CISY_COXBU Citrate synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=gltA PE=3 SV=1 123 452 2.0E-20
sp|P51041|CISY_RICCA Citrate synthase (Fragment) OS=Rickettsia canadensis GN=gltA PE=3 SV=2 85 456 4.0E-20
sp|Q9ZN37|CISY_HELPJ Citrate synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=gltA PE=3 SV=1 124 471 6.0E-20
sp|P51034|CISY_BARQU Citrate synthase OS=Bartonella quintana (strain Toulouse) GN=gltA PE=3 SV=3 123 485 6.0E-20
sp|Q59778|CISY_RICSI Citrate synthase (Fragment) OS=Rickettsia sibirica GN=gltA PE=3 SV=1 123 456 9.0E-20
sp|Q59759|CISY_RICPA Citrate synthase (Fragment) OS=Rickettsia parkeri GN=gltA PE=3 SV=1 123 456 9.0E-20
sp|P0ABH7|CISY_ECOLI Citrate synthase OS=Escherichia coli (strain K12) GN=gltA PE=1 SV=1 123 475 1.0E-19
sp|P0ABH8|CISY_ECOL6 Citrate synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gltA PE=3 SV=1 123 475 1.0E-19
sp|P51033|CISY_BARHE Citrate synthase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gltA PE=3 SV=1 123 485 1.0E-19
sp|P51040|CISY_RICFE Citrate synthase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=gltA PE=3 SV=2 123 456 1.0E-19
sp|Q59776|CISY_RICS1 Citrate synthase OS=Rickettsia slovaca (strain 13-B) GN=gltA PE=3 SV=2 123 456 2.0E-19
sp|Q59742|CISY_RICJA Citrate synthase (Fragment) OS=Rickettsia japonica GN=gltA PE=3 SV=1 123 456 2.0E-19
sp|Q59768|CISY_RICRH Citrate synthase (Fragment) OS=Rickettsia rhipicephali GN=gltA PE=3 SV=1 123 456 2.0E-19
sp|Q59748|CISY_RICMA Citrate synthase (Fragment) OS=Rickettsia massiliae GN=gltA PE=3 SV=1 123 456 2.0E-19
sp|Q9RWB2|CISY_DEIRA Citrate synthase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=gltA PE=1 SV=3 119 452 2.0E-19
sp|Q59136|CISY_RICC1 Citrate synthase (Fragment) OS=Rickettsia conorii subsp. caspia (strain A-167) GN=gltA PE=3 SV=1 123 456 3.0E-19
sp|Q59732|CISY_RICAE Citrate synthase OS=Rickettsia africae (strain ESF-5) GN=gltA PE=3 SV=2 123 456 3.0E-19
sp|Q59730|CISY_RICAK Citrate synthase (Fragment) OS=Rickettsia akari GN=gltA PE=3 SV=1 46 471 4.0E-19
sp|P51042|CISY_RICCN Citrate synthase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=gltA PE=3 SV=3 123 456 4.0E-19
sp|P14165|CISY_PSEAE Citrate synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gltA PE=3 SV=2 123 452 5.0E-19
sp|P80148|CISY_SULSO Citrate synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gltA PE=1 SV=3 70 458 7.0E-19
sp|Q59939|CISY_STRMU Citrate synthase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=citZ PE=3 SV=2 119 475 7.0E-19
sp|P56062|CISY_HELPY Citrate synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=gltA PE=3 SV=1 124 471 8.0E-19
sp|P51043|CISY_RICTY Citrate synthase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=gltA PE=3 SV=3 123 456 8.0E-19
sp|P51039|CISY_RICAU Citrate synthase (Fragment) OS=Rickettsia australis GN=gltA PE=3 SV=2 85 456 9.0E-19
sp|O68883|CISY_SALTY Citrate synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gltA PE=3 SV=1 123 475 1.0E-18
sp|Q59258|CISY_BARTA Citrate synthase (Fragment) OS=Bartonella taylorii GN=gltA PE=3 SV=1 123 435 1.0E-18
sp|Q9LXS7|CISY1_ARATH Citrate synthase 1, peroxisomal OS=Arabidopsis thaliana GN=CSY1 PE=2 SV=1 85 454 2.0E-18
sp|P51045|CISY_ACIFR Citrate synthase OS=Acidithiobacillus ferrooxidans GN=gltA PE=3 SV=1 119 463 2.0E-18
sp|P09948|CISY_RICPR Citrate synthase OS=Rickettsia prowazekii (strain Madrid E) GN=gltA PE=3 SV=1 123 456 2.0E-18
sp|Q53554|CISY_PYRFU Citrate synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=gltA PE=1 SV=2 87 452 2.0E-18
sp|P51036|CISY_BARVI Citrate synthase (Fragment) OS=Bartonella vinsonii GN=gltA PE=3 SV=2 123 435 9.0E-18
sp|P39120|CISY2_BACSU Citrate synthase 2 OS=Bacillus subtilis (strain 168) GN=citZ PE=1 SV=2 119 472 2.0E-17
sp|P51032|CISY_BAREL Citrate synthase (Fragment) OS=Bartonella elizabethae GN=gltA PE=3 SV=2 123 435 2.0E-17
sp|Q59198|CISY_BARDO Citrate synthase (Fragment) OS=Bartonella doshiae GN=gltA PE=3 SV=1 123 435 5.0E-17
sp|P51031|CISY_BARBA Citrate synthase (Fragment) OS=Bartonella bacilliformis GN=gltA PE=3 SV=2 123 435 7.0E-17
sp|P21553|CISY_THEAC Citrate synthase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=gltA PE=1 SV=2 85 452 5.0E-16
sp|Q8MQU6|CISYP_DICDI Citrate synthase, peroxisomal OS=Dictyostelium discoideum GN=cshA PE=2 SV=1 85 458 3.0E-15
sp|P27660|CISY_BACCO Citrate synthase OS=Bacillus coagulans GN=ctsA PE=3 SV=1 121 475 4.0E-15
sp|D4GS06|CISY_HALVD Citrate synthase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=citZ PE=1 SV=1 119 482 6.0E-15
sp|Q86AV6|CISYC_DICDI Citrate synthase OS=Dictyostelium discoideum GN=gltA PE=3 SV=1 123 454 6.0E-15
sp|P45858|MMGD_BACSU 2-methylcitrate synthase OS=Bacillus subtilis (strain 168) GN=mmgD PE=1 SV=1 121 462 3.0E-14
sp|Q8EJW2|PRPC_SHEON 2-methylcitrate synthase OS=Shewanella oneidensis (strain MR-1) GN=prpC PE=3 SV=1 119 366 7.0E-14
sp|P39119|CISY_BACSU Citrate synthase 1 OS=Bacillus subtilis (strain 168) GN=citA PE=1 SV=2 70 475 3.0E-13
sp|O34002|PRPC_ABDS2 2-methylcitrate synthase OS=Antarctic bacterium DS2-3R GN=gltA PE=1 SV=1 119 358 7.0E-12
sp|Q56063|PRPC_SALTY 2-methylcitrate synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prpC PE=1 SV=2 119 474 7.0E-11
sp|Q937N9|PRPC_CUPNE 2-methylcitrate synthase OS=Cupriavidus necator GN=prpC PE=1 SV=1 119 474 4.0E-10
sp|Q8NSH7|PRPC1_CORGL 2-methylcitrate synthase 1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=prpC1 PE=1 SV=1 98 358 1.0E-09
sp|Q8NSL1|PRPC2_CORGL 2-methylcitrate synthase 2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=prpC2 PE=1 SV=1 119 358 8.0E-09
sp|I6Y9Q3|PRPC_MYCTU 2-methylcitrate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=prpC PE=1 SV=1 119 358 5.0E-08
sp|H8F0D7|PRPC_MYCTE 2-methylcitrate synthase OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=gltA1 PE=1 SV=1 119 358 5.0E-08
sp|P26491|CISY_MYCSM Citrate synthase OS=Mycobacterium smegmatis GN=gltA PE=3 SV=1 119 358 7.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0046912 acyltransferase activity, acyl groups converted into alkyl on transfer Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016746 acyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6125
MASLVRLSNPALRAISGRTATLNAVRCYSAKTQTLKERLAELLPEKIEQIKKLRQESGSKVVDKVTLDQVYGGAR
GIKCLVWEGSVLDAEEGIRFRGKTIPECQKLLPKAPGGKEPLPEGLFWLLLTGEVPTEKQVRDLSAEWAARSAVP
KFVEELIDHCPIDLHPMAQFSLAVTALEHTSTFAKAYAKGINKKDYWGYTFEDSMDLIAKLPNIAARIYQNVFKG
GKVAPVQADKDYSFNFANQLGFGSNTDFVELLRLYLTIHTDHEGGNVSAHTTHLVGSALSSPYLSLAAGLNGLAG
PLHGLANQEVLNWLTEMKKSVGDDLSDKAITDYLWSTLRSGRVVPGYGHAVLRKTDPRYMAQREFALGWWRPPNR
KLGSGLLTRLAEKMPDDAMFKLVSQVYKIAPGVLTEHGKTKNPYPNVDAHSGVLLQHYGLTEANYYTVLFGVSRA
IGVLPQLILDRAFGAPIERPKSYSTDKWIEICKKL*
Coding >Ophun1|6125
ATGGCCTCCCTCGTGCGCCTCAGCAACCCTGCCCTACGGGCTATAAGCGGTCGCACGGCCACCTTGAACGCCGTG
CGATGCTACTCGGCCAAGACGCAGACACTCAAGGAACGACTTGCCGAGCTGCTCCCAGAAAAGATTGAGCAGATC
AAGAAGCTTCGACAAGAGAGCGGTTCCAAGGTGGTGGATAAAGTCACACTCGATCAGGTCTACGGGGGAGCTCGT
GGAATCAAGTGCCTCGTCTGGGAGGGCTCCGTTCTCGACGCAGAAGAGGGCATCCGCTTCCGCGGCAAGACGATT
CCCGAATGCCAGAAGCTTCTACCCAAGGCTCCCGGCGGAAAGGAGCCTCTGCCCGAAGGCCTCTTCTGGCTGCTC
CTCACCGGCGAGGTGCCGACGGAGAAGCAAGTCCGCGACCTCTCTGCCGAATGGGCCGCCCGATCGGCCGTGCCC
AAGTTCGTCGAGGAGCTCATCGATCACTGCCCCATCGATCTCCACCCCATGGCGCAGTTCTCGCTGGCCGTGACG
GCGCTGGAACACACGTCGACGTTTGCCAAGGCATACGCCAAGGGCATCAACAAGAAGGACTACTGGGGCTACACG
TTTGAGGACTCGATGGATCTGATTGCCAAGCTGCCCAACATTGCGGCGCGCATCTACCAAAACGTCTTCAAGGGC
GGCAAGGTGGCACCCGTGCAGGCCGACAAGGACTACTCGTTCAACTTTGCCAACCAGCTTGGCTTTGGCAGCAAC
ACCGACTTTGTCGAGCTGCTCCGTCTCTACCTGACGATTCACACGGACCACGAGGGCGGCAACGTCAGCGCCCAC
ACGACGCACCTCGTTGGGAGTGCCCTCAGCTCGCCCTACCTGTCGCTGGCGGCCGGGCTCAACGGGCTGGCCGGG
CCGCTGCACGGGCTGGCCAACCAGGAGGTGCTCAACTGGCTGACGGAGATGAAGAAGTCGGTGGGCGACGACCTC
AGTGACAAGGCCATCACCGACTACCTTTGGTCGACGCTGCGGTCCGGCCGCGTGGTCCCCGGCTACGGCCACGCC
GTTCTCCGCAAGACGGACCCGCGCTACATGGCCCAGCGCGAGTTTGCCCTCGGTTGGTGGCGGCCCCCAAATCGG
AAGCTGGGATCTGGTCTGCTGACAAGGCTCGCAGAGAAAATGCCCGACGATGCCATGTTCAAGCTGGTCAGCCAG
GTTTACAAGATTGCGCCGGGGGTGTTGACGGAGCACGGCAAGACCAAGAACCCGTACCCCAACGTGGACGCGCAC
TCGGGCGTGCTGCTGCAGCACTACGGGCTGACGGAAGCCAACTACTACACGGTCCTGTTTGGCGTGTCCCGGGCC
ATCGGCGTGCTGCCGCAGCTGATCCTGGACCGGGCCTTTGGAGCGCCCATCGAGCGGCCCAAGTCGTACTCTACG
GACAAGTGGATCGAGATATGCAAGAAGCTGTAA
Transcript >Ophun1|6125
ATGGCCTCCCTCGTGCGCCTCAGCAACCCTGCCCTACGGGCTATAAGCGGTCGCACGGCCACCTTGAACGCCGTG
CGATGCTACTCGGCCAAGACGCAGACACTCAAGGAACGACTTGCCGAGCTGCTCCCAGAAAAGATTGAGCAGATC
AAGAAGCTTCGACAAGAGAGCGGTTCCAAGGTGGTGGATAAAGTCACACTCGATCAGGTCTACGGGGGAGCTCGT
GGAATCAAGTGCCTCGTCTGGGAGGGCTCCGTTCTCGACGCAGAAGAGGGCATCCGCTTCCGCGGCAAGACGATT
CCCGAATGCCAGAAGCTTCTACCCAAGGCTCCCGGCGGAAAGGAGCCTCTGCCCGAAGGCCTCTTCTGGCTGCTC
CTCACCGGCGAGGTGCCGACGGAGAAGCAAGTCCGCGACCTCTCTGCCGAATGGGCCGCCCGATCGGCCGTGCCC
AAGTTCGTCGAGGAGCTCATCGATCACTGCCCCATCGATCTCCACCCCATGGCGCAGTTCTCGCTGGCCGTGACG
GCGCTGGAACACACGTCGACGTTTGCCAAGGCATACGCCAAGGGCATCAACAAGAAGGACTACTGGGGCTACACG
TTTGAGGACTCGATGGATCTGATTGCCAAGCTGCCCAACATTGCGGCGCGCATCTACCAAAACGTCTTCAAGGGC
GGCAAGGTGGCACCCGTGCAGGCCGACAAGGACTACTCGTTCAACTTTGCCAACCAGCTTGGCTTTGGCAGCAAC
ACCGACTTTGTCGAGCTGCTCCGTCTCTACCTGACGATTCACACGGACCACGAGGGCGGCAACGTCAGCGCCCAC
ACGACGCACCTCGTTGGGAGTGCCCTCAGCTCGCCCTACCTGTCGCTGGCGGCCGGGCTCAACGGGCTGGCCGGG
CCGCTGCACGGGCTGGCCAACCAGGAGGTGCTCAACTGGCTGACGGAGATGAAGAAGTCGGTGGGCGACGACCTC
AGTGACAAGGCCATCACCGACTACCTTTGGTCGACGCTGCGGTCCGGCCGCGTGGTCCCCGGCTACGGCCACGCC
GTTCTCCGCAAGACGGACCCGCGCTACATGGCCCAGCGCGAGTTTGCCCTCGGTTGGTGGCGGCCCCCAAATCGG
AAGCTGGGATCTGGTCTGCTGACAAGGCTCGCAGAGAAAATGCCCGACGATGCCATGTTCAAGCTGGTCAGCCAG
GTTTACAAGATTGCGCCGGGGGTGTTGACGGAGCACGGCAAGACCAAGAACCCGTACCCCAACGTGGACGCGCAC
TCGGGCGTGCTGCTGCAGCACTACGGGCTGACGGAAGCCAACTACTACACGGTCCTGTTTGGCGTGTCCCGGGCC
ATCGGCGTGCTGCCGCAGCTGATCCTGGACCGGGCCTTTGGAGCGCCCATCGAGCGGCCCAAGTCGTACTCTACG
GACAAGTGGATCGAGATATGCAAGAAGCTGTAA
Gene >Ophun1|6125
ATGGCCTCCCTCGTGCGCCTCAGCAACCCTGCCCTACGGGCTATAAGCGGTCGCACGGCCACCTTGAACGCCGTG
CGATGCTACTCGGCCAAGACGCAGGTCAGTTATCCCCTTGCTTCTTGGGTCGAGAGCTCGCTGACGTTTCCCTTT
TGCAGACACTCAAGGAACGACTTGCCGAGCTGCTCCCAGAAAAGATTGAGCAGATCAAGAAGCTTCGACAGTCGG
TGGCGCCGCCCATGGCCGGTTCTGCATGCGTCCGCTGACGTGCTCGATATCCAGAGAGAGCGGTTCCAAGGTGGT
GGATAAAGTCACACTCGATCAGGTCTACGGGGGAGCTCGTGGAATCAAGTGCCTCGTCTGGGAGGGCTCCGTTCT
CGACGCAGAAGAGGGCATCCGCTTCCGCGGCAAGACGATTCCCGAATGCCAGAAGCTTCTACCCAAGGCTCCCGG
CGGAAAGGAGCCTCTGCCCGAAGGTGAGTGAGGCTCTGCCCCAGCTGGCCTCGTCTGACTCCATGTGCAGGCCTC
TTCTGGCTGCTCCTCACCGGCGAGGTGCCGACGGAGAAGCAAGTCCGCGACCTCTCTGCCGAATGGGCCGCCCGA
TCGGCCGTGCCCAAGTTCGTCGAGGAGCTCATCGATCACTGCCCCATCGATCTCCACCCCATGGCGCAGTTCTCG
CTGGCCGTGACGGCGCTGGAACACACGTCGACGTTTGCCAAGGCATACGCCAAGGGCATCAACAAGAAGGACTAC
TGGGGCTACACGTTTGAGGACTCGATGGATCTGATTGCCAAGCTGCCCAACATTGCGGCGCGCATCTACCAAAAC
GTCTTCAAGGGCGGCAAGGTGGCACCCGTGCAGGCCGACAAGGACTACTCGTTCAACTTTGCCAACCAGCTTGGC
TTTGGCAGCAACACCGACTTTGTCGAGCTGCTCCGTCTCTACCTGACGATTCACACGGACCACGAGGGCGGCAAC
GTCAGCGCCCACACGACGCACCTCGTTGGGAGTGCCCTCAGCTCGCCCTACCTGTCGCTGGCGGCCGGGCTCAAC
GGGCTGGCCGGGCCGCTGCACGGGCTGGCCAACCAGGAGGTGCTCAACTGGCTGACGGAGATGAAGAAGTCGGTG
GGCGACGACCTCAGTGACAAGGCCATCACCGACTACCTTTGGTCGACGCTGCGGTCCGGCCGCGTGGTCCCCGGC
TACGGCCACGCCGTTCTCCGCAAGACGGACCCGCGCTACATGGCCCAGCGCGAGTTTGCCCTCGGTTGGTGGCGG
CCCCCAAATCGGAAGCTGGGATCTGGTCTGCTGACAAGGCTCGCAGAGAAAATGCCCGACGATGCCATGTTCAAG
CTGGTCAGCCAGGTTTACAAGATTGCGCCGGGGGTGTTGACGGAGCACGGCAAGACCAAGAACCCGTACCCCAAC
GTGGACGCGCACTCGGGCGTGCTGCTGCAGCACTACGGGCTGACGGAAGCCAACTACTACACGGTCCTGTTTGGC
GTGTCCCGGGCCATCGGCGTGCTGCCGCAGCTGATCCTGGACCGGGCCTTTGGAGCGCCCATCGAGCGGCCCAAG
TCGTACTCTACGGACAAGTGGATCGAGATATGCAAGAAGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail