Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6121
Gene name
LocationContig_647:6672..7286
Strand-
Gene length (bp)614
Transcript length (bp)465
Coding sequence length (bp)465
Protein length (aa) 155

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13279 4HBT_2 Thioesterase-like superfamily 1.3E-08 24 131
PF03061 4HBT Thioesterase superfamily 9.9E-08 33 106
PF01643 Acyl-ACP_TE Acyl-ACP thioesterase 1.5E-04 12 51

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0006633 fatty acid biosynthetic process Yes
GO:0016790 thiolester hydrolase activity Yes
GO:0044237 cellular metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0044238 primary metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No
GO:0006629 lipid metabolic process No
GO:0009987 cellular process No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0043436 oxoacid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0044255 cellular lipid metabolic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0006082 organic acid metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0032787 monocarboxylic acid metabolic process No
GO:0008150 biological_process No
GO:0006631 fatty acid metabolic process No
GO:0044281 small molecule metabolic process No
GO:0016787 hydrolase activity No
GO:0072330 monocarboxylic acid biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0016053 organic acid biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5842
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7375
Ophiocordyceps australis map64 (Brazil) OphauB2|2340
Ophiocordyceps camponoti-floridani Ophcf2|02525
Ophiocordyceps camponoti-rufipedis Ophun1|6121 (this protein)
Ophiocordyceps kimflemingae Ophio5|5898

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6121
MPAPASRRDRRREDYPFVLDYRTRWNDNDMYDHVNNSIYNFLFDSVVNAYLADHCGIHPPNSPQHPLVAHTETDY
FRSIAYPAVAEVGLRVVRLGRSSVRYELGLFERGVEPVCAVCDFVHVFVDRAHGRPSPGGLGPDLRAGLERIALP
TAKI*
Coding >Ophun1|6121
ATGCCGGCGCCTGCCTCACGCCGGGATCGTCGCCGCGAAGACTATCCCTTTGTGCTCGACTACCGCACCCGTTGG
AACGACAACGACATGTACGACCACGTCAACAACTCCATCTACAACTTCCTCTTCGACTCCGTCGTCAACGCCTAC
CTCGCCGACCACTGCGGCATCCACCCCCCCAACTCGCCCCAGCACCCCCTCGTCGCCCACACCGAGACGGATTAC
TTCCGATCAATAGCCTACCCTGCCGTCGCCGAAGTCGGCCTCCGCGTCGTCCGTCTCGGCCGGTCCAGCGTCAGG
TACGAACTCGGCCTGTTTGAGCGAGGCGTCGAGCCCGTCTGCGCCGTCTGCGACTTCGTCCACGTCTTTGTCGAT
CGCGCCCACGGTCGGCCCAGCCCGGGCGGACTGGGGCCGGATCTGCGTGCCGGGCTCGAGCGCATTGCCCTTCCC
ACTGCCAAGATCTGA
Transcript >Ophun1|6121
ATGCCGGCGCCTGCCTCACGCCGGGATCGTCGCCGCGAAGACTATCCCTTTGTGCTCGACTACCGCACCCGTTGG
AACGACAACGACATGTACGACCACGTCAACAACTCCATCTACAACTTCCTCTTCGACTCCGTCGTCAACGCCTAC
CTCGCCGACCACTGCGGCATCCACCCCCCCAACTCGCCCCAGCACCCCCTCGTCGCCCACACCGAGACGGATTAC
TTCCGATCAATAGCCTACCCTGCCGTCGCCGAAGTCGGCCTCCGCGTCGTCCGTCTCGGCCGGTCCAGCGTCAGG
TACGAACTCGGCCTGTTTGAGCGAGGCGTCGAGCCCGTCTGCGCCGTCTGCGACTTCGTCCACGTCTTTGTCGAT
CGCGCCCACGGTCGGCCCAGCCCGGGCGGACTGGGGCCGGATCTGCGTGCCGGGCTCGAGCGCATTGCCCTTCCC
ACTGCCAAGATCTGA
Gene >Ophun1|6121
ATGCCGGCGCCTGCCTCACGCCGGGATCGTCGCCGCGAAGACTATCCCTTTGTGCTCGACTACCGCACCCGTTGG
TACTTGATTGTCTTCTCCCTTTCGATGACTATAACCACTGACGGGGTCGACCAGGAACGACAACGACATGTACGA
CCACGTCAACAACTCCATCTACAACTTCCTGTCGGTCCTCTTCCCTCTTCTCTCCAGTTCCCTCTTCTCTCCTCT
CCAGATAACCCCCTCCCAACCCTCAATGCTCACAACTGCGAAACCCCAGCTTCGACTCCGTCGTCAACGCCTACC
TCGCCGACCACTGCGGCATCCACCCCCCCAACTCGCCCCAGCACCCCCTCGTCGCCCACACCGAGACGGATTACT
TCCGATCAATAGCCTACCCTGCCGTCGCCGAAGTCGGCCTCCGCGTCGTCCGTCTCGGCCGGTCCAGCGTCAGGT
ACGAACTCGGCCTGTTTGAGCGAGGCGTCGAGCCCGTCTGCGCCGTCTGCGACTTCGTCCACGTCTTTGTCGATC
GCGCCCACGGTCGGCCCAGCCCGGGCGGACTGGGGCCGGATCTGCGTGCCGGGCTCGAGCGCATTGCCCTTCCCA
CTGCCAAGATCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail