Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6118
Gene name
LocationContig_646:8613..10323
Strand-
Gene length (bp)1710
Transcript length (bp)1575
Coding sequence length (bp)1575
Protein length (aa) 525

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 1.0E-08 313 357
PF17123 zf-RING_11 RING-like zinc finger 2.9E-06 313 342

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q1MTR5|YG66_SCHPO Uncharacterized RING finger membrane protein C15C4.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.06c PE=3 SV=1 50 357 4.0E-11
sp|Q8LDB8|RING2_ARATH E3 ubiquitin-protein ligase At1g63170 OS=Arabidopsis thaliana GN=At1g63170 PE=2 SV=2 314 361 8.0E-07
sp|Q9LN71|RING1_ARATH E3 ubiquitin-protein ligase At1g12760 OS=Arabidopsis thaliana GN=At1g12760 PE=1 SV=1 313 361 9.0E-07
sp|Q6GPV5|RN181_XENLA E3 ubiquitin-protein ligase RNF181 OS=Xenopus laevis GN=rnf181 PE=2 SV=1 313 386 2.0E-06
sp|Q9SUS4|RHA1A_ARATH RING-H2 zinc finger protein RHA1a OS=Arabidopsis thaliana GN=RHA1A PE=2 SV=1 314 363 6.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 172 194 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6118
MSAPDLDGTFGGLLFVPQITAVPDCDSQQYNFLPHNVTRREQLPPSNLNVVAIAPWFSIECTRAYLSSAARGSAR
AIIFYKPNNSTNKPQEVDSPVWSLDDDDDWRRNYHFPIFAIPGLEGQKMVLQLSLYSGSIDQVPHGQEISQLYGP
NPSDYVRVWTELTMQNTSNVPAVWAFVLIVIAALLFVIAVVSLAMHFIQRRNRSSLQRRVQSGEVDLEAMGIKRL
TVPASHVDRFPLFTYNAEAELADAPRSPVDAHPRRPSRKGRRPETRSAPADAASSAGPRSVRSLRSIRSKRSSIA
GTTDTTATNFQPNCHICLAGFEHCKTVIRELPCGHIFHPACIDEFLTQNSSLCPMCKHCMLPRGYSPKITNGMVR
REQAVRRLREHIDFEDSSVDSGELKLREWGKRFFAKSDAAVDPGAAPAGDASSASATPAPDAPPQARPSPSHKAE
ARRTRPRALRLLPTHHEGVEPKEDATAVGRLSPSSFARERMRQIAESNAPFDDDLDSRRPKWRRALSKAFPGFS*
Coding >Ophun1|6118
ATGTCCGCGCCTGACCTCGACGGCACCTTTGGCGGCCTCCTCTTCGTCCCCCAGATCACCGCCGTCCCCGACTGC
GACTCCCAGCAGTACAACTTTCTCCCCCACAATGTCACCCGCCGCGAGCAGCTCCCCCCCAGCAACCTCAACGTC
GTCGCCATCGCCCCCTGGTTCAGCATCGAATGCACCCGCGCCTACCTCTCCTCCGCCGCCCGCGGCTCTGCCCGC
GCCATCATCTTTTACAAACCCAACAACTCGACCAACAAGCCCCAGGAAGTCGACTCGCCCGTCTGGAGCCTTGAC
GATGACGACGACTGGCGCAGGAACTATCACTTTCCCATCTTCGCAATCCCGGGCCTCGAGGGCCAGAAGATGGTG
CTGCAGCTGAGCCTCTACTCGGGCTCCATCGACCAGGTGCCCCACGGCCAAGAGATCAGCCAGCTCTACGGGCCC
AACCCCAGCGACTACGTCCGCGTCTGGACCGAACTGACGATGCAGAATACGTCCAACGTCCCCGCCGTCTGGGCC
TTTGTCCTCATCGTCATCGCCGCCCTGCTCTTCGTCATCGCCGTCGTCTCCCTCGCCATGCACTTCATCCAGCGC
CGGAATCGCTCCTCCCTCCAGCGCCGCGTTCAGTCGGGCGAGGTCGACCTCGAGGCCATGGGCATCAAGCGTCTG
ACCGTCCCGGCCTCCCACGTTGACCGCTTCCCGCTCTTCACCTACAACGCCGAGGCCGAGCTGGCCGACGCCCCG
CGCTCCCCCGTCGACGCCCACCCTCGGAGGCCCTCGCGCAAGGGCCGGCGCCCCGAGACGCGCTCCGCCCCGGCC
GACGCCGCCAGCTCGGCCGGTCCTCGGAGCGTCCGCAGCCTGCGCAGCATCCGCAGCAAGAGGTCGAGCATCGCG
GGGACCACCGACACCACGGCCACCAACTTCCAGCCCAACTGTCACATCTGCCTCGCCGGCTTCGAGCACTGCAAG
ACGGTCATCCGCGAGCTGCCCTGCGGCCACATCTTCCACCCGGCCTGCATCGACGAGTTCCTGACGCAAAACAGC
TCGCTGTGCCCCATGTGCAAGCACTGCATGCTGCCCCGCGGCTACAGCCCCAAGATCACAAACGGCATGGTCCGT
CGCGAGCAGGCCGTGCGCCGACTGAGGGAGCACATCGACTTTGAGGACTCGTCGGTCGACTCGGGCGAGCTGAAG
CTCAGGGAATGGGGCAAGCGCTTCTTCGCCAAATCGGACGCAGCTGTCGACCCCGGCGCCGCCCCGGCCGGAGAC
GCTTCCTCGGCATCGGCCACGCCCGCGCCGGACGCGCCCCCCCAAGCCCGGCCGTCCCCGTCCCACAAGGCGGAG
GCGCGGAGGACGCGGCCCCGGGCCCTCAGGCTGCTACCAACGCACCACGAGGGGGTCGAACCGAAGGAGGACGCT
ACGGCCGTCGGGCGCCTGAGCCCCTCGTCGTTTGCCCGGGAGCGGATGCGGCAGATTGCCGAGAGCAACGCGCCC
TTTGACGACGACCTGGACAGTCGGCGTCCCAAGTGGCGACGAGCGCTGTCCAAGGCCTTTCCCGGCTTTTCGTAG
Transcript >Ophun1|6118
ATGTCCGCGCCTGACCTCGACGGCACCTTTGGCGGCCTCCTCTTCGTCCCCCAGATCACCGCCGTCCCCGACTGC
GACTCCCAGCAGTACAACTTTCTCCCCCACAATGTCACCCGCCGCGAGCAGCTCCCCCCCAGCAACCTCAACGTC
GTCGCCATCGCCCCCTGGTTCAGCATCGAATGCACCCGCGCCTACCTCTCCTCCGCCGCCCGCGGCTCTGCCCGC
GCCATCATCTTTTACAAACCCAACAACTCGACCAACAAGCCCCAGGAAGTCGACTCGCCCGTCTGGAGCCTTGAC
GATGACGACGACTGGCGCAGGAACTATCACTTTCCCATCTTCGCAATCCCGGGCCTCGAGGGCCAGAAGATGGTG
CTGCAGCTGAGCCTCTACTCGGGCTCCATCGACCAGGTGCCCCACGGCCAAGAGATCAGCCAGCTCTACGGGCCC
AACCCCAGCGACTACGTCCGCGTCTGGACCGAACTGACGATGCAGAATACGTCCAACGTCCCCGCCGTCTGGGCC
TTTGTCCTCATCGTCATCGCCGCCCTGCTCTTCGTCATCGCCGTCGTCTCCCTCGCCATGCACTTCATCCAGCGC
CGGAATCGCTCCTCCCTCCAGCGCCGCGTTCAGTCGGGCGAGGTCGACCTCGAGGCCATGGGCATCAAGCGTCTG
ACCGTCCCGGCCTCCCACGTTGACCGCTTCCCGCTCTTCACCTACAACGCCGAGGCCGAGCTGGCCGACGCCCCG
CGCTCCCCCGTCGACGCCCACCCTCGGAGGCCCTCGCGCAAGGGCCGGCGCCCCGAGACGCGCTCCGCCCCGGCC
GACGCCGCCAGCTCGGCCGGTCCTCGGAGCGTCCGCAGCCTGCGCAGCATCCGCAGCAAGAGGTCGAGCATCGCG
GGGACCACCGACACCACGGCCACCAACTTCCAGCCCAACTGTCACATCTGCCTCGCCGGCTTCGAGCACTGCAAG
ACGGTCATCCGCGAGCTGCCCTGCGGCCACATCTTCCACCCGGCCTGCATCGACGAGTTCCTGACGCAAAACAGC
TCGCTGTGCCCCATGTGCAAGCACTGCATGCTGCCCCGCGGCTACAGCCCCAAGATCACAAACGGCATGGTCCGT
CGCGAGCAGGCCGTGCGCCGACTGAGGGAGCACATCGACTTTGAGGACTCGTCGGTCGACTCGGGCGAGCTGAAG
CTCAGGGAATGGGGCAAGCGCTTCTTCGCCAAATCGGACGCAGCTGTCGACCCCGGCGCCGCCCCGGCCGGAGAC
GCTTCCTCGGCATCGGCCACGCCCGCGCCGGACGCGCCCCCCCAAGCCCGGCCGTCCCCGTCCCACAAGGCGGAG
GCGCGGAGGACGCGGCCCCGGGCCCTCAGGCTGCTACCAACGCACCACGAGGGGGTCGAACCGAAGGAGGACGCT
ACGGCCGTCGGGCGCCTGAGCCCCTCGTCGTTTGCCCGGGAGCGGATGCGGCAGATTGCCGAGAGCAACGCGCCC
TTTGACGACGACCTGGACAGTCGGCGTCCCAAGTGGCGACGAGCGCTGTCCAAGGCCTTTCCCGGCTTTTCGTAG
Gene >Ophun1|6118
ATGTCCGCGCCTGACGTCTCCCAAGAGCCAAATAGGCTACGAGGATCGCATAACTACCAACCTCACTACCCTCGC
CACCACAAATGCCCCCAAGCTCGACGGCACCTTTGGCGGCCTCCTCTTCGTCCCCCAGATCACCGCCGTCCCCGA
CTGCGACTCCCAGCAGTACAACTTTCTCCCCCACAATGTCACCCGCCGCGAGCAGCTCCCCCCCAGCAACCTCAA
CGTCGTCGCCATCGCCCCCTGGTTCAGCATCGAATGCACCCGCGCCTACCTCTCCTCCGCCGCCCGCGGCTCTGC
CCGCGCCATCATCTTTTACAAACCCAACAACTCGACCAACAAGCCCCAGGAAGTCGACTCGCCCGTCTGGAGCCT
TGACGATGACGACGACTGGCGCAGGAACTATCACTTTCCCATCTTCGCAATCCCGGGCCTCGAGGGCCAGAAGAT
GGTGCTGCAGCTGAGCCTCTACTCGGGCTCCATCGACCAGGTGCCCCACGGCCAAGAGATCAGCCAGCTCTACGG
GCCCAACCCCAGCGACTACGTCCGCGTCTGGACCGAACTGACGATGCAGAATACGTCCAACGTCCCCGCCGTCTG
GGCCTTTGTCCTCATCGTCATCGCCGCCCTGCTCTTCGTCATCGCCGTCGTCTCCCTCGCCATGCACTTCATCCA
GCGCCGGAATCGCTCCTCCCTCCAGCGCCGCGTTCAGTCGGGCGAGGTCGACCTCGAGGCCATGGGCATCAAGCG
TCTGACCGTCCCGGCCTCCCACGTTGACCGCTTCCCGCTCTTCACCTACAACGCCGAGGCCGAGCTGGCCGACGC
CCCGCGCTCCCCCGTCGACGCCCACCCTCGGAGGCCCTCGCGCAAGGGCCGGCGCCCCGAGACGCGCTCCGCCCC
GGCCGACGCCGCCAGCTCGGCCGGTCCTCGGAGCGTCCGCAGCCTGCGCAGCATCCGCAGCAAGAGGTCGAGCAT
CGCGGGGACCACCGACACCACGGCCACCAACTTCCAGCCCAACTGTCACATCTGCCTCGCCGGCTTCGAGCACTG
CAAGACGGTCATCCGCGAGCTGCCCTGCGGCCACATCTTCCACCCGGCCTGCATCGACGAGTTCCTGACGCAAAA
CAGCTCGCTGTGCCCCATGTGCAAGCACTGCATGCTGCCCCGCGGCTACAGCCCCAAGATCACAAACGGCATGGT
CCGTCGCGAGCAGGCCGTGCGCCGACTGAGGGAGCACATCGACTTTGAGGACTCGTCGGTCGACTCGGGCGAGCT
GAAGCTCAGGGAATGGGGCAAGCGCTTCTTCGCCAAATCGGACGCAGCTGTCGACCCCGGCGCCGCCCCGGCCGG
AGACGCTTCCTCGGCATCGGCCACGCCCGCGCCGGACGCGCCCCCCCAAGCCCGGCCGTCCCCGTCCCACAAGGC
GGAGGCGCGGAGGACGCGGCCCCGGGCCCTCAGGCTGCTACCAACGCACCACGAGGGGGTCGAACCGAAGGAGGA
CGCTACGGCCGTCGGGCGCCTGAGCCCCTCGTCGTTTGCCCGGGAGCGGATGCGGCAGATTGCCGAGAGCAACGC
GCCCTTTGACGACGACCTGGACAGTCGGCGTCCCAAGTGTAAGCCCCCCCCTTGTCCAGGGCCTCCCGAGGTTCG
CTGCTGACACTGTTTGCAGGGCGACGAGCGCTGTCCAAGGCCTTTCCCGGCTTTTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail