Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6114
Gene name
LocationContig_646:794..2591
Strand-
Gene length (bp)1797
Transcript length (bp)1737
Coding sequence length (bp)1737
Protein length (aa) 579

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74949|YJBC_SCHPO Uncharacterized protein C553.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC553.12c PE=4 SV=2 64 576 2.0E-81

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

Domain # Start End Length
1 150 172 22
2 187 209 22
3 222 244 22
4 309 331 22
5 351 373 22
6 383 405 22
7 465 487 22
8 507 529 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6114
MSFFQFTQGTEAHSRPSDSSPLLGRYRAVPPRRDRRRRVSLGGRGSVHVGYGALMAAELAAADDDDDEDGRGQRA
ERTLLQAWLLDLWVVPRQSAVKRVVDRWWSRYGVLVVLPTALVVGWCAVPLPQYPLDTEPEPGKTPGHGAARVRL
NFWFFLLVYYGLYSLTALAWITKVFNLYSLNWWPRSLGFPLTLSLVGALSVAVPVPVYWGSRTRFLTEHNTAWIA
WTFVVMALPVAMALAILMTNARHVGGRHELSETQRIFTSSWWSAEPGRGTVPSSSEEAMPAAVPTTTSTTAAAAA
AAASGWHPASFVRFLWLCVALSIGLLAYVLGEAYAELYLGTLPHNSLETVVYVYGWVATVHLLDALTGWTLGIRE
GERVGSYPLSWVFKLYFTLTYQTYVRALYARLRSPSQFVVLQLLSSTSLVVLTPLSMTRRYHGLLVATGLNGQSF
GSYQKLQARNVFIRFLAENASMATFLASIAVLHYGANRDVYPYFALDDQAEPYDLALTLWASSVTWACEMVASLA
VRALIRLCFAVDVGVEGRQDLAVWPELLPTCVTVTLHVLQNMMFSIIRLQFYD*
Coding >Ophun1|6114
ATGTCCTTCTTCCAGTTCACGCAGGGCACCGAGGCGCACTCACGACCCAGCGACTCGTCACCGCTGCTGGGCCGG
TACCGTGCCGTGCCGCCACGACGCGATCGGCGGAGGCGGGTGTCGCTGGGCGGACGAGGGAGCGTCCACGTCGGA
TACGGGGCTTTGATGGCGGCGGAGCTGGCGGCGGCCGACGACGACGATGACGAGGATGGCCGAGGGCAGCGGGCG
GAGAGGACTCTGTTGCAGGCCTGGCTGCTGGATCTGTGGGTGGTGCCCAGGCAGTCGGCGGTGAAGCGGGTGGTG
GACCGGTGGTGGAGTCGATACGGGGTGCTGGTGGTGCTGCCGACGGCGCTGGTGGTGGGCTGGTGCGCAGTGCCG
CTGCCGCAGTACCCGCTGGACACGGAGCCGGAGCCGGGCAAGACGCCGGGCCACGGGGCGGCACGAGTGCGGCTC
AACTTCTGGTTCTTCCTGCTGGTGTACTACGGGCTGTACAGCCTGACGGCGCTGGCGTGGATCACAAAGGTGTTT
AACCTGTACAGCCTGAACTGGTGGCCGCGGTCGCTGGGGTTCCCGCTTACGCTGTCGCTGGTGGGCGCGCTGTCG
GTTGCGGTGCCGGTTCCGGTGTATTGGGGTTCGCGGACGAGGTTCCTGACGGAGCATAATACGGCGTGGATTGCG
TGGACGTTTGTGGTCATGGCCCTGCCGGTTGCCATGGCGCTGGCCATCCTCATGACCAACGCGCGGCATGTTGGC
GGTCGTCACGAGCTGTCGGAGACGCAGCGCATCTTTACGTCTTCGTGGTGGAGCGCCGAGCCGGGCCGGGGGACT
GTTCCGTCGTCGTCGGAAGAGGCGATGCCGGCAGCCGTACCGACGACGACATCGACGACAGCAGCAGCAGCAGCA
GCAGCAGCATCGGGCTGGCATCCCGCCAGCTTCGTCCGCTTCCTCTGGCTCTGCGTCGCGCTGTCGATAGGTCTA
CTGGCGTACGTCCTCGGCGAGGCCTACGCAGAGCTCTACCTCGGCACCCTCCCGCACAACAGTCTGGAGACGGTC
GTCTACGTCTACGGCTGGGTGGCGACGGTGCATCTGCTCGACGCGCTGACGGGCTGGACGCTGGGGATTCGCGAG
GGCGAGCGCGTCGGCAGCTACCCTCTCAGCTGGGTCTTCAAGCTCTACTTTACCCTGACGTATCAGACGTACGTC
CGCGCTCTATACGCCCGTCTGCGATCGCCGTCGCAGTTTGTTGTTCTGCAGCTGCTCTCTTCCACGTCGTTGGTG
GTGCTCACGCCGCTTTCCATGACGCGCCGCTATCATGGCCTGCTGGTGGCTACGGGCCTCAACGGGCAGAGCTTC
GGCTCGTACCAGAAGCTACAGGCGCGCAACGTCTTCATCCGGTTCCTGGCGGAGAATGCGTCCATGGCGACGTTT
CTAGCCAGCATCGCCGTCCTGCACTACGGCGCCAACCGCGACGTGTACCCTTACTTTGCGCTCGACGACCAGGCA
GAGCCGTACGATCTGGCCTTGACGCTATGGGCCTCGTCTGTTACCTGGGCTTGCGAGATGGTGGCCAGCCTTGCC
GTTCGCGCATTGATACGGTTGTGTTTCGCCGTGGATGTTGGGGTCGAGGGGAGGCAGGATCTTGCAGTGTGGCCT
GAGTTGCTGCCCACGTGCGTGACAGTGACGCTGCATGTGTTGCAGAATATGATGTTTTCCATCATCCGGCTGCAG
TTTTACGACTAA
Transcript >Ophun1|6114
ATGTCCTTCTTCCAGTTCACGCAGGGCACCGAGGCGCACTCACGACCCAGCGACTCGTCACCGCTGCTGGGCCGG
TACCGTGCCGTGCCGCCACGACGCGATCGGCGGAGGCGGGTGTCGCTGGGCGGACGAGGGAGCGTCCACGTCGGA
TACGGGGCTTTGATGGCGGCGGAGCTGGCGGCGGCCGACGACGACGATGACGAGGATGGCCGAGGGCAGCGGGCG
GAGAGGACTCTGTTGCAGGCCTGGCTGCTGGATCTGTGGGTGGTGCCCAGGCAGTCGGCGGTGAAGCGGGTGGTG
GACCGGTGGTGGAGTCGATACGGGGTGCTGGTGGTGCTGCCGACGGCGCTGGTGGTGGGCTGGTGCGCAGTGCCG
CTGCCGCAGTACCCGCTGGACACGGAGCCGGAGCCGGGCAAGACGCCGGGCCACGGGGCGGCACGAGTGCGGCTC
AACTTCTGGTTCTTCCTGCTGGTGTACTACGGGCTGTACAGCCTGACGGCGCTGGCGTGGATCACAAAGGTGTTT
AACCTGTACAGCCTGAACTGGTGGCCGCGGTCGCTGGGGTTCCCGCTTACGCTGTCGCTGGTGGGCGCGCTGTCG
GTTGCGGTGCCGGTTCCGGTGTATTGGGGTTCGCGGACGAGGTTCCTGACGGAGCATAATACGGCGTGGATTGCG
TGGACGTTTGTGGTCATGGCCCTGCCGGTTGCCATGGCGCTGGCCATCCTCATGACCAACGCGCGGCATGTTGGC
GGTCGTCACGAGCTGTCGGAGACGCAGCGCATCTTTACGTCTTCGTGGTGGAGCGCCGAGCCGGGCCGGGGGACT
GTTCCGTCGTCGTCGGAAGAGGCGATGCCGGCAGCCGTACCGACGACGACATCGACGACAGCAGCAGCAGCAGCA
GCAGCAGCATCGGGCTGGCATCCCGCCAGCTTCGTCCGCTTCCTCTGGCTCTGCGTCGCGCTGTCGATAGGTCTA
CTGGCGTACGTCCTCGGCGAGGCCTACGCAGAGCTCTACCTCGGCACCCTCCCGCACAACAGTCTGGAGACGGTC
GTCTACGTCTACGGCTGGGTGGCGACGGTGCATCTGCTCGACGCGCTGACGGGCTGGACGCTGGGGATTCGCGAG
GGCGAGCGCGTCGGCAGCTACCCTCTCAGCTGGGTCTTCAAGCTCTACTTTACCCTGACGTATCAGACGTACGTC
CGCGCTCTATACGCCCGTCTGCGATCGCCGTCGCAGTTTGTTGTTCTGCAGCTGCTCTCTTCCACGTCGTTGGTG
GTGCTCACGCCGCTTTCCATGACGCGCCGCTATCATGGCCTGCTGGTGGCTACGGGCCTCAACGGGCAGAGCTTC
GGCTCGTACCAGAAGCTACAGGCGCGCAACGTCTTCATCCGGTTCCTGGCGGAGAATGCGTCCATGGCGACGTTT
CTAGCCAGCATCGCCGTCCTGCACTACGGCGCCAACCGCGACGTGTACCCTTACTTTGCGCTCGACGACCAGGCA
GAGCCGTACGATCTGGCCTTGACGCTATGGGCCTCGTCTGTTACCTGGGCTTGCGAGATGGTGGCCAGCCTTGCC
GTTCGCGCATTGATACGGTTGTGTTTCGCCGTGGATGTTGGGGTCGAGGGGAGGCAGGATCTTGCAGTGTGGCCT
GAGTTGCTGCCCACGTGCGTGACAGTGACGCTGCATGTGTTGCAGAATATGATGTTTTCCATCATCCGGCTGCAG
TTTTACGACTAA
Gene >Ophun1|6114
ATGTCCTTCTTCCAGTTCACGCAGGGCACCGAGGCGCACTCACGACCCAGCGACTCGTCACCGCTGCTGGGCCGG
TACCGTGCCGTGCCGCCACGACGCGATCGGCGGAGGCGGGTGTCGCTGGGCGGACGAGGGAGCGTCCACGTCGGA
TACGGGGCTTTGATGGCGGCGGAGCTGGCGGCGGCCGACGACGACGATGACGAGGATGGCCGAGGGCAGCGGGCG
GAGAGGACTCTGTTGCAGGCCTGGCTGCTGGATCTGTGGGTGGTGCCCAGGCAGTCGGCGGTGAAGCGGGTGGTG
GACCGGTGGTGGAGTCGATACGGGGTGCTGGTGGTGCTGCCGACGGCGCTGGTGAGGCTCCTCGAGGAATCCAGG
CGGTGATGGGCAATGTCCCCAACTGACGTTGAACAGGTGGTGGGCTGGTGCGCAGTGCCGCTGCCGCAGTACCCG
CTGGACACGGAGCCGGAGCCGGGCAAGACGCCGGGCCACGGGGCGGCACGAGTGCGGCTCAACTTCTGGTTCTTC
CTGCTGGTGTACTACGGGCTGTACAGCCTGACGGCGCTGGCGTGGATCACAAAGGTGTTTAACCTGTACAGCCTG
AACTGGTGGCCGCGGTCGCTGGGGTTCCCGCTTACGCTGTCGCTGGTGGGCGCGCTGTCGGTTGCGGTGCCGGTT
CCGGTGTATTGGGGTTCGCGGACGAGGTTCCTGACGGAGCATAATACGGCGTGGATTGCGTGGACGTTTGTGGTC
ATGGCCCTGCCGGTTGCCATGGCGCTGGCCATCCTCATGACCAACGCGCGGCATGTTGGCGGTCGTCACGAGCTG
TCGGAGACGCAGCGCATCTTTACGTCTTCGTGGTGGAGCGCCGAGCCGGGCCGGGGGACTGTTCCGTCGTCGTCG
GAAGAGGCGATGCCGGCAGCCGTACCGACGACGACATCGACGACAGCAGCAGCAGCAGCAGCAGCAGCATCGGGC
TGGCATCCCGCCAGCTTCGTCCGCTTCCTCTGGCTCTGCGTCGCGCTGTCGATAGGTCTACTGGCGTACGTCCTC
GGCGAGGCCTACGCAGAGCTCTACCTCGGCACCCTCCCGCACAACAGTCTGGAGACGGTCGTCTACGTCTACGGC
TGGGTGGCGACGGTGCATCTGCTCGACGCGCTGACGGGCTGGACGCTGGGGATTCGCGAGGGCGAGCGCGTCGGC
AGCTACCCTCTCAGCTGGGTCTTCAAGCTCTACTTTACCCTGACGTATCAGACGTACGTCCGCGCTCTATACGCC
CGTCTGCGATCGCCGTCGCAGTTTGTTGTTCTGCAGCTGCTCTCTTCCACGTCGTTGGTGGTGCTCACGCCGCTT
TCCATGACGCGCCGCTATCATGGCCTGCTGGTGGCTACGGGCCTCAACGGGCAGAGCTTCGGCTCGTACCAGAAG
CTACAGGCGCGCAACGTCTTCATCCGGTTCCTGGCGGAGAATGCGTCCATGGCGACGTTTCTAGCCAGCATCGCC
GTCCTGCACTACGGCGCCAACCGCGACGTGTACCCTTACTTTGCGCTCGACGACCAGGCAGAGCCGTACGATCTG
GCCTTGACGCTATGGGCCTCGTCTGTTACCTGGGCTTGCGAGATGGTGGCCAGCCTTGCCGTTCGCGCATTGATA
CGGTTGTGTTTCGCCGTGGATGTTGGGGTCGAGGGGAGGCAGGATCTTGCAGTGTGGCCTGAGTTGCTGCCCACG
TGCGTGACAGTGACGCTGCATGTGTTGCAGAATATGATGTTTTCCATCATCCGGCTGCAGTTTTACGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail