Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6113
Gene name
LocationContig_645:4914..10269
Strand+
Gene length (bp)5355
Transcript length (bp)4590
Coding sequence length (bp)4590
Protein length (aa) 1530

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02735 Ku Ku70/Ku80 beta-barrel domain 6.3E-42 263 450
PF03731 Ku_N Ku70/Ku80 N-terminal alpha/beta domain 1.2E-30 31 231
PF03730 Ku_C Ku70/Ku80 C-terminal arm 2.4E-25 479 564
PF02037 SAP SAP domain 4.4E-10 591 625
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 2.4E-07 1142 1177

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H0I3|KU70_CHAGB ATP-dependent DNA helicase II subunit 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=KU70 PE=3 SV=1 1 629 0.0E+00
sp|Q2MHH4|KU70_ASPOR ATP-dependent DNA helicase II subunit 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ku70 PE=3 SV=1 23 627 0.0E+00
sp|Q1DU75|KU70_COCIM ATP-dependent DNA helicase II subunit 1 OS=Coccidioides immitis (strain RS) GN=KU70 PE=3 SV=2 23 626 0.0E+00
sp|Q2MHH3|KU70_ASPSO ATP-dependent DNA helicase II subunit 1 OS=Aspergillus sojae GN=ku70 PE=3 SV=1 23 627 0.0E+00
sp|Q5AVC7|KU70_EMENI ATP-dependent DNA helicase II subunit 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ku70 PE=3 SV=1 45 614 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H0I3|KU70_CHAGB ATP-dependent DNA helicase II subunit 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=KU70 PE=3 SV=1 1 629 0.0E+00
sp|Q2MHH4|KU70_ASPOR ATP-dependent DNA helicase II subunit 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ku70 PE=3 SV=1 23 627 0.0E+00
sp|Q1DU75|KU70_COCIM ATP-dependent DNA helicase II subunit 1 OS=Coccidioides immitis (strain RS) GN=KU70 PE=3 SV=2 23 626 0.0E+00
sp|Q2MHH3|KU70_ASPSO ATP-dependent DNA helicase II subunit 1 OS=Aspergillus sojae GN=ku70 PE=3 SV=1 23 627 0.0E+00
sp|Q5AVC7|KU70_EMENI ATP-dependent DNA helicase II subunit 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ku70 PE=3 SV=1 45 614 0.0E+00
sp|Q0U5F2|KU70_PHANO ATP-dependent DNA helicase II subunit 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=KU70 PE=3 SV=1 23 626 0.0E+00
sp|Q7SA95|KU70_NEUCR ATP-dependent DNA helicase II subunit 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-51 PE=3 SV=2 5 628 0.0E+00
sp|O94395|KU70_SCHPO ATP-dependent DNA helicase II subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pku70 PE=1 SV=1 12 627 1.0E-96
sp|Q6CCK2|KU70_YARLI ATP-dependent DNA helicase II subunit 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KU70 PE=3 SV=1 12 626 4.0E-88
sp|P23475|XRCC6_MOUSE X-ray repair cross-complementing protein 6 OS=Mus musculus GN=Xrcc6 PE=1 SV=5 29 628 1.0E-60
sp|Q26228|KU70_RHIAP ATP-dependent DNA helicase 2 subunit 1 OS=Rhipicephalus appendiculatus GN=ku70 PE=2 SV=1 5 626 7.0E-59
sp|O93257|XRCC6_CHICK X-ray repair cross-complementing protein 5 OS=Gallus gallus GN=XRCC6 PE=2 SV=1 29 625 5.0E-57
sp|P12956|XRCC6_HUMAN X-ray repair cross-complementing protein 6 OS=Homo sapiens GN=XRCC6 PE=1 SV=2 29 627 7.0E-56
sp|Q9FQ08|KU70_ARATH ATP-dependent DNA helicase 2 subunit KU70 OS=Arabidopsis thaliana GN=KU70 PE=1 SV=1 26 621 2.0E-47
sp|P0CO50|KU70_CRYNJ ATP-dependent DNA helicase II subunit 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=KU70 PE=3 SV=1 111 554 4.0E-40
sp|P0CO51|KU70_CRYNB ATP-dependent DNA helicase II subunit 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=KU70 PE=3 SV=1 111 554 4.0E-40
sp|Q7F1M0|KU70_ORYSJ ATP-dependent DNA helicase 2 subunit KU70 OS=Oryza sativa subsp. japonica GN=KU70 PE=1 SV=1 26 621 2.0E-39
sp|Q54MA9|KU70_DICDI ATP-dependent DNA helicase ku70 OS=Dictyostelium discoideum GN=ku70 PE=3 SV=1 27 420 2.0E-28
sp|Q6CUB4|KU70_KLULA ATP-dependent DNA helicase II subunit 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KU70 PE=3 SV=1 60 527 4.0E-25
sp|P32807|KU70_YEAST ATP-dependent DNA helicase II subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKU70 PE=1 SV=2 15 505 4.0E-24
sp|Q23976|KU70_DROME ATP-dependent DNA helicase 2 subunit 1 OS=Drosophila melanogaster GN=Irbp PE=2 SV=3 75 422 7.0E-16
sp|Q9FQ09|KU80_ARATH ATP-dependent DNA helicase 2 subunit KU80 OS=Arabidopsis thaliana GN=KU80 PE=1 SV=1 65 576 9.0E-09
sp|Q05958|ECM22_YEAST Sterol regulatory element-binding protein ECM22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM22 PE=1 SV=1 1125 1189 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0003677 DNA binding Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0006303 double-strand break repair via nonhomologous end joining Yes
GO:0003678 DNA helicase activity Yes
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0006259 DNA metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0050896 response to stimulus No
GO:0006725 cellular aromatic compound metabolic process No
GO:0010468 regulation of gene expression No
GO:0043170 macromolecule metabolic process No
GO:0019222 regulation of metabolic process No
GO:0051716 cellular response to stimulus No
GO:0051252 regulation of RNA metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0140657 ATP-dependent activity No
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0060255 regulation of macromolecule metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0008152 metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0140110 transcription regulator activity No
GO:0009987 cellular process No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0003824 catalytic activity No
GO:1901363 heterocyclic compound binding No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0044238 primary metabolic process No
GO:0046914 transition metal ion binding No
GO:0044237 cellular metabolic process No
GO:0043169 cation binding No
GO:0031326 regulation of cellular biosynthetic process No
GO:0050789 regulation of biological process No
GO:0006807 nitrogen compound metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0065007 biological regulation No
GO:0006950 response to stress No
GO:0004386 helicase activity No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006302 double-strand break repair No
GO:1901360 organic cyclic compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0090304 nucleic acid metabolic process No
GO:0050794 regulation of cellular process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0140097 catalytic activity, acting on DNA No
GO:0006974 cellular response to DNA damage stimulus No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0003700 DNA-binding transcription factor activity No
GO:0033554 cellular response to stress No
GO:0006281 DNA repair No
GO:0043167 ion binding No
GO:0019219 regulation of nucleobase-containing compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2600
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5310
Ophiocordyceps australis map64 (Brazil) OphauB2|4239
Ophiocordyceps camponoti-floridani Ophcf2|04206
Ophiocordyceps camponoti-rufipedis Ophun1|6113 (this protein)
Ophiocordyceps kimflemingae Ophio5|8008
Ophiocordyceps subramaniannii Hirsu2|3932

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6113
MTDANQDWRMEENDEAEQEIDETSYKAQKDALLIAIEVSESMLKPPPPSDDRKADRDSPLQAALKCAHHLMEQRI
ISNPRDMIGILLFGTRESKFRYADDASGGLGYTNCYVFTDLDVPAAEDVKAVRDLIDGGEEEEKNILKPTSEAMS
MANVLFCANQIFTIKAANFGSRRLFIITDNDDPHSADRAAVSSAAVRAKDLYDLGVSIDLFPIARDDSKFDLTKF
YDDIVYGDGLTLLNSLLTNINSKQTPKRALFSNLPFEIAPGLRISVKGFNIMHRQTPARTCYVWLDGERPQIATG
ETTRVAEDSTRTVKKNEVKKAYKFGGEFVYFTPEEQKTLRDFGPPIIRILGFKPRASIPFWASVKKSTFIYPSEE
DYVGSTRVFSALWQKLLQDDLVAMAWCIVRANAQPILAAVRPSREPDVEGSPTPFLPAGLWLYPLPFADDVREAK
RTAEVCQGSDELKSRMRVIVQQLQLPKAMYNPAKYPNPALQWHFKILKALALDEEVPEKAEDATEPRYKAIGKRV
GGYLDEWSHRLDQETGVVSNSRRAKREAEDQESGRPAKKNRGSPEKASGSNMTTQQLQMAIESGGITKMTVAQLR
DVAAARGLSTAGRKMEIVERLEQWLEEDATATNRPAYCIDVFYLLRRCAFPSPPKAVDYSERVIGRRFAPDSPSA
CALVTAAAMADFLASFNLSGDDGARPPSACASIDELQLRLQDLLAHKSTATRAEHVAANLEIGANAMLNVGLTAA
ENGVLEGLNNLDPSLGGLDSSSLETDGEQMMRSVRAIDTLKNQPTDDPVLQRAVANLIVSTVSNTEGSSWAMNDM
SLGDRGWNFVYLCMDSSRQWDLVSKEQAKSIIGEYTLREPDPTLMSRPAYDCRGCVRVSFPRDSRSILIKYDHTP
FHRTVAEVAEFYKPPPRQMVAPKAKTPKKTGSGRKKRDSTKANGETSTPRKRKKTASQPQDADATAMTNEQQPLA
ELGQNSQPFIETAEGGFVDGLAPDATVTEGQGHPQAPASQAIPLNLSPEEAARRRDVATKLLSDAGVDPDTLSTE
QFNIFANQSPELQKESLNMLVKYGAERLRIVHPSNRDSSASVPPSAAAPTAQAATISAPLTEPVGDTGAGTLTPA
TKTGSGKKLRTPGKSRKACNQCKGRKVKCPKERPTCAECQTQGMTCVYAPTKPRPKKPKSDEFAPPEYNVDDESQ
MQPADATQMTLETEGDSTMLEARDEGSQGGGDAVPEEDLDEDGPGEEELQEAEDEEDEEEAKGASSPEETQQDET
SFSAYPQVPVSDMLAPSVDVAPQQQQQQQQQQATSTPYFRSASGLALPQPEPQLMPAAEEDMMMAPQYQPPPTTH
QSQTSDEAMQQLLESPTQPSNKPVVSRRSLPTAPARHEAVDGWSGVANSNIPRHSESHTSSTQMQDAMALSQAAL
EHQRQTHSMPTAMQPSHRSTLSHPANDSRMKSRLGQRPPTMHDGYPSSSSMGNSRYRSTSGLQPSYNSFGGYADD
QGENKIGYEPYTFQRNSQTEQPRPTISPA*
Coding >Ophun1|6113
ATGACGGACGCCAACCAAGACTGGAGGATGGAGGAAAACGATGAGGCTGAGCAGGAAATCGACGAGACTAGCTAC
AAGGCGCAGAAGGATGCCCTTCTCATAGCTATCGAAGTCAGCGAGTCGATGCTCAAGCCGCCGCCCCCTTCCGAC
GACAGAAAGGCAGACCGGGACAGCCCGCTACAAGCAGCGCTGAAATGCGCCCACCACTTGATGGAACAGCGCATC
ATTTCCAATCCGAGGGACATGATTGGCATTCTTCTTTTCGGCACGAGGGAATCCAAGTTTCGATATGCCGATGAT
GCTTCAGGCGGCCTGGGTTATACAAACTGCTATGTCTTTACGGACCTGGACGTTCCCGCCGCAGAGGATGTTAAG
GCTGTTCGAGATCTCATCGACGGGGGCGAAGAAGAGGAGAAGAACATTCTAAAGCCTACAAGTGAGGCTATGTCA
ATGGCAAACGTCCTCTTCTGCGCCAATCAGATATTCACCATCAAGGCCGCCAACTTTGGCAGTCGGCGCCTGTTC
ATCATTACCGATAATGACGATCCCCATTCTGCAGACAGAGCAGCCGTCTCGTCTGCAGCTGTTCGTGCTAAAGAT
CTGTACGATCTGGGCGTGTCGATTGATCTGTTTCCGATCGCTCGCGACGACTCCAAGTTCGACTTGACCAAGTTC
TACGACGACATTGTCTATGGAGATGGGTTGACGTTGCTCAACTCCCTGCTCACCAACATTAACTCGAAACAAACA
CCAAAGCGGGCTTTGTTCTCTAATTTACCATTTGAGATAGCCCCCGGACTTCGTATATCCGTGAAAGGCTTCAAC
ATTATGCATCGCCAGACGCCGGCGCGGACTTGCTATGTCTGGCTCGATGGGGAGAGGCCTCAGATAGCCACCGGC
GAGACGACACGGGTTGCAGAGGACAGCACTCGGACGGTGAAGAAGAATGAGGTTAAGAAGGCTTATAAGTTTGGC
GGAGAGTTCGTCTACTTTACTCCGGAGGAGCAAAAGACACTTCGAGACTTTGGCCCTCCGATTATTCGCATTCTG
GGCTTCAAGCCTCGCGCTTCGATACCATTCTGGGCAAGCGTGAAGAAGTCGACCTTCATTTACCCCAGCGAGGAA
GATTACGTGGGCTCGACTCGTGTCTTCAGCGCGCTATGGCAGAAACTGCTGCAAGACGACTTGGTGGCCATGGCG
TGGTGCATCGTGCGAGCAAATGCCCAGCCGATTCTCGCAGCCGTCAGGCCATCCAGGGAACCAGATGTAGAAGGC
TCTCCGACACCATTTCTGCCGGCTGGTCTCTGGCTTTACCCGCTCCCTTTCGCAGACGATGTCAGGGAGGCGAAG
CGGACAGCGGAAGTCTGTCAGGGCTCCGACGAGCTCAAGTCTCGGATGAGAGTCATCGTGCAGCAGCTGCAGCTG
CCCAAGGCCATGTACAACCCTGCAAAATACCCGAACCCGGCCTTGCAGTGGCATTTCAAAATCCTCAAGGCCCTG
GCGCTCGATGAAGAGGTGCCGGAGAAGGCAGAGGACGCGACGGAGCCCAGGTATAAAGCCATTGGCAAGCGGGTG
GGCGGCTATCTTGATGAATGGTCCCACAGGCTGGACCAAGAGACGGGAGTGGTCTCGAACTCGAGAAGGGCGAAA
CGCGAGGCGGAAGATCAAGAGTCAGGTCGTCCCGCGAAGAAGAACCGAGGCAGTCCTGAAAAGGCGAGCGGGTCG
AACATGACAACGCAGCAGCTCCAGATGGCCATTGAGAGCGGTGGAATCACAAAGATGACGGTCGCGCAGTTGAGG
GACGTGGCAGCAGCTCGGGGATTGAGCACGGCCGGGCGGAAGATGGAGATTGTGGAGAGGCTGGAACAGTGGTTG
GAGGAGGATGCTACGGCGACAAACCGTCCCGCTTACTGCATCGACGTCTTCTACCTACTGCGCCGCTGCGCGTTT
CCCTCCCCGCCCAAAGCCGTCGACTATTCAGAGCGCGTCATCGGCCGCCGTTTCGCCCCGGACTCGCCCAGCGCG
TGCGCCCTCGTGACAGCGGCGGCAATGGCCGACTTCCTGGCCAGCTTCAACCTGAGCGGCGACGATGGCGCCCGA
CCGCCTTCGGCTTGCGCGTCCATCGATGAGCTGCAACTGCGCCTTCAGGATCTTCTCGCTCACAAGTCGACAGCC
ACCCGCGCCGAACACGTGGCTGCCAATCTCGAGATAGGAGCCAATGCTATGCTCAATGTCGGCCTCACGGCGGCA
GAGAACGGCGTGCTGGAGGGCCTCAACAATCTCGATCCCTCCCTCGGCGGCCTCGACTCTTCCAGCTTGGAGACC
GACGGCGAGCAGATGATGCGCAGCGTTCGCGCGATAGATACGCTCAAGAACCAACCGACCGATGACCCCGTGCTG
CAGAGGGCCGTTGCCAACCTCATCGTCTCGACCGTCAGCAACACCGAGGGCAGTTCGTGGGCTATGAACGACATG
TCGCTCGGTGACCGGGGCTGGAACTTTGTCTACCTTTGCATGGATTCTAGTCGGCAGTGGGATCTGGTCAGCAAA
GAACAGGCAAAATCCATCATCGGCGAGTATACGCTGAGAGAACCAGACCCGACCCTGATGAGCAGACCGGCCTAC
GACTGTCGAGGCTGCGTTCGCGTCTCCTTCCCTCGTGACAGCCGGTCAATACTGATAAAGTACGATCATACGCCT
TTTCACAGGACCGTGGCCGAGGTAGCCGAATTCTACAAGCCGCCTCCGCGGCAGATGGTGGCTCCCAAAGCCAAG
ACGCCCAAGAAGACAGGCTCTGGACGTAAGAAGCGCGACTCGACCAAAGCAAATGGCGAAACCAGCACGCCGAGG
AAGCGCAAGAAGACGGCGTCGCAGCCGCAAGATGCTGACGCGACAGCAATGACGAACGAGCAGCAGCCTCTCGCC
GAATTGGGTCAGAACAGCCAGCCGTTCATTGAGACCGCAGAGGGAGGCTTCGTTGACGGGCTCGCTCCGGACGCG
ACAGTGACGGAAGGACAGGGTCATCCACAGGCACCGGCCAGCCAGGCGATTCCTCTCAATCTCTCGCCGGAGGAG
GCGGCGCGACGGCGCGACGTGGCTACCAAGCTGCTGAGCGACGCGGGCGTCGACCCGGACACGCTGTCGACGGAG
CAATTCAACATCTTTGCCAACCAGTCGCCCGAGTTGCAAAAGGAGTCTCTTAACATGCTTGTTAAGTACGGCGCT
GAAAGGCTCCGCATTGTACATCCGAGCAATAGGGACAGCTCGGCTTCGGTGCCGCCCAGCGCAGCAGCGCCGACG
GCGCAAGCAGCAACCATTTCGGCCCCTTTGACGGAGCCCGTGGGCGACACGGGAGCAGGTACTTTGACTCCCGCG
ACCAAGACGGGCTCGGGCAAGAAGTTGAGGACGCCCGGCAAGTCGCGCAAAGCGTGCAACCAGTGCAAAGGACGC
AAGGTCAAGTGCCCAAAAGAACGTCCCACGTGCGCCGAGTGCCAGACGCAAGGCATGACGTGTGTATACGCACCG
ACGAAGCCTCGACCGAAGAAGCCCAAGTCGGATGAGTTTGCGCCGCCCGAGTACAACGTCGACGACGAGTCGCAG
ATGCAGCCGGCGGACGCTACGCAGATGACGCTGGAAACTGAAGGAGATAGCACCATGCTCGAGGCTCGAGACGAA
GGCTCGCAGGGGGGAGGAGATGCGGTCCCGGAAGAAGACTTGGATGAAGATGGTCCAGGGGAGGAGGAGCTGCAG
GAAGCAGAAGACGAAGAGGATGAGGAAGAAGCCAAGGGCGCGTCTTCTCCAGAAGAGACGCAGCAGGACGAGACG
AGCTTCTCGGCCTACCCACAGGTGCCCGTCTCCGACATGCTGGCTCCCAGCGTGGACGTTGCTCCCCAGCAGCAG
CAGCAGCAACAGCAGCAGCAGGCAACGTCGACGCCGTACTTCCGATCGGCCTCGGGCCTCGCCTTGCCGCAGCCG
GAGCCGCAACTCATGCCGGCAGCCGAAGAAGACATGATGATGGCTCCCCAGTACCAACCTCCACCGACGACGCAC
CAGAGCCAGACATCAGACGAAGCGATGCAACAGCTCCTCGAGTCTCCCACGCAACCATCCAACAAACCCGTCGTC
TCTCGAAGAAGCCTCCCGACAGCACCAGCCCGTCACGAAGCCGTAGACGGCTGGTCAGGCGTGGCAAACTCCAAC
ATCCCACGCCACAGCGAATCCCACACGTCGTCAACGCAGATGCAAGACGCCATGGCCCTCTCACAAGCAGCTCTC
GAACACCAGCGCCAAACACACAGCATGCCGACGGCGATGCAACCCTCGCACCGATCAACGCTATCTCACCCTGCC
AACGATTCGCGCATGAAGTCGCGGCTGGGTCAACGGCCGCCGACGATGCACGATGGCTACCCGTCTTCGTCGTCC
ATGGGCAACAGTCGCTATCGGTCCACGTCTGGACTGCAGCCCTCGTATAACTCGTTCGGTGGCTATGCTGATGAT
CAGGGCGAGAATAAGATTGGCTATGAGCCCTACACGTTTCAGCGGAACAGCCAGACGGAACAACCTCGCCCTACG
ATCTCCCCGGCATAA
Transcript >Ophun1|6113
ATGACGGACGCCAACCAAGACTGGAGGATGGAGGAAAACGATGAGGCTGAGCAGGAAATCGACGAGACTAGCTAC
AAGGCGCAGAAGGATGCCCTTCTCATAGCTATCGAAGTCAGCGAGTCGATGCTCAAGCCGCCGCCCCCTTCCGAC
GACAGAAAGGCAGACCGGGACAGCCCGCTACAAGCAGCGCTGAAATGCGCCCACCACTTGATGGAACAGCGCATC
ATTTCCAATCCGAGGGACATGATTGGCATTCTTCTTTTCGGCACGAGGGAATCCAAGTTTCGATATGCCGATGAT
GCTTCAGGCGGCCTGGGTTATACAAACTGCTATGTCTTTACGGACCTGGACGTTCCCGCCGCAGAGGATGTTAAG
GCTGTTCGAGATCTCATCGACGGGGGCGAAGAAGAGGAGAAGAACATTCTAAAGCCTACAAGTGAGGCTATGTCA
ATGGCAAACGTCCTCTTCTGCGCCAATCAGATATTCACCATCAAGGCCGCCAACTTTGGCAGTCGGCGCCTGTTC
ATCATTACCGATAATGACGATCCCCATTCTGCAGACAGAGCAGCCGTCTCGTCTGCAGCTGTTCGTGCTAAAGAT
CTGTACGATCTGGGCGTGTCGATTGATCTGTTTCCGATCGCTCGCGACGACTCCAAGTTCGACTTGACCAAGTTC
TACGACGACATTGTCTATGGAGATGGGTTGACGTTGCTCAACTCCCTGCTCACCAACATTAACTCGAAACAAACA
CCAAAGCGGGCTTTGTTCTCTAATTTACCATTTGAGATAGCCCCCGGACTTCGTATATCCGTGAAAGGCTTCAAC
ATTATGCATCGCCAGACGCCGGCGCGGACTTGCTATGTCTGGCTCGATGGGGAGAGGCCTCAGATAGCCACCGGC
GAGACGACACGGGTTGCAGAGGACAGCACTCGGACGGTGAAGAAGAATGAGGTTAAGAAGGCTTATAAGTTTGGC
GGAGAGTTCGTCTACTTTACTCCGGAGGAGCAAAAGACACTTCGAGACTTTGGCCCTCCGATTATTCGCATTCTG
GGCTTCAAGCCTCGCGCTTCGATACCATTCTGGGCAAGCGTGAAGAAGTCGACCTTCATTTACCCCAGCGAGGAA
GATTACGTGGGCTCGACTCGTGTCTTCAGCGCGCTATGGCAGAAACTGCTGCAAGACGACTTGGTGGCCATGGCG
TGGTGCATCGTGCGAGCAAATGCCCAGCCGATTCTCGCAGCCGTCAGGCCATCCAGGGAACCAGATGTAGAAGGC
TCTCCGACACCATTTCTGCCGGCTGGTCTCTGGCTTTACCCGCTCCCTTTCGCAGACGATGTCAGGGAGGCGAAG
CGGACAGCGGAAGTCTGTCAGGGCTCCGACGAGCTCAAGTCTCGGATGAGAGTCATCGTGCAGCAGCTGCAGCTG
CCCAAGGCCATGTACAACCCTGCAAAATACCCGAACCCGGCCTTGCAGTGGCATTTCAAAATCCTCAAGGCCCTG
GCGCTCGATGAAGAGGTGCCGGAGAAGGCAGAGGACGCGACGGAGCCCAGGTATAAAGCCATTGGCAAGCGGGTG
GGCGGCTATCTTGATGAATGGTCCCACAGGCTGGACCAAGAGACGGGAGTGGTCTCGAACTCGAGAAGGGCGAAA
CGCGAGGCGGAAGATCAAGAGTCAGGTCGTCCCGCGAAGAAGAACCGAGGCAGTCCTGAAAAGGCGAGCGGGTCG
AACATGACAACGCAGCAGCTCCAGATGGCCATTGAGAGCGGTGGAATCACAAAGATGACGGTCGCGCAGTTGAGG
GACGTGGCAGCAGCTCGGGGATTGAGCACGGCCGGGCGGAAGATGGAGATTGTGGAGAGGCTGGAACAGTGGTTG
GAGGAGGATGCTACGGCGACAAACCGTCCCGCTTACTGCATCGACGTCTTCTACCTACTGCGCCGCTGCGCGTTT
CCCTCCCCGCCCAAAGCCGTCGACTATTCAGAGCGCGTCATCGGCCGCCGTTTCGCCCCGGACTCGCCCAGCGCG
TGCGCCCTCGTGACAGCGGCGGCAATGGCCGACTTCCTGGCCAGCTTCAACCTGAGCGGCGACGATGGCGCCCGA
CCGCCTTCGGCTTGCGCGTCCATCGATGAGCTGCAACTGCGCCTTCAGGATCTTCTCGCTCACAAGTCGACAGCC
ACCCGCGCCGAACACGTGGCTGCCAATCTCGAGATAGGAGCCAATGCTATGCTCAATGTCGGCCTCACGGCGGCA
GAGAACGGCGTGCTGGAGGGCCTCAACAATCTCGATCCCTCCCTCGGCGGCCTCGACTCTTCCAGCTTGGAGACC
GACGGCGAGCAGATGATGCGCAGCGTTCGCGCGATAGATACGCTCAAGAACCAACCGACCGATGACCCCGTGCTG
CAGAGGGCCGTTGCCAACCTCATCGTCTCGACCGTCAGCAACACCGAGGGCAGTTCGTGGGCTATGAACGACATG
TCGCTCGGTGACCGGGGCTGGAACTTTGTCTACCTTTGCATGGATTCTAGTCGGCAGTGGGATCTGGTCAGCAAA
GAACAGGCAAAATCCATCATCGGCGAGTATACGCTGAGAGAACCAGACCCGACCCTGATGAGCAGACCGGCCTAC
GACTGTCGAGGCTGCGTTCGCGTCTCCTTCCCTCGTGACAGCCGGTCAATACTGATAAAGTACGATCATACGCCT
TTTCACAGGACCGTGGCCGAGGTAGCCGAATTCTACAAGCCGCCTCCGCGGCAGATGGTGGCTCCCAAAGCCAAG
ACGCCCAAGAAGACAGGCTCTGGACGTAAGAAGCGCGACTCGACCAAAGCAAATGGCGAAACCAGCACGCCGAGG
AAGCGCAAGAAGACGGCGTCGCAGCCGCAAGATGCTGACGCGACAGCAATGACGAACGAGCAGCAGCCTCTCGCC
GAATTGGGTCAGAACAGCCAGCCGTTCATTGAGACCGCAGAGGGAGGCTTCGTTGACGGGCTCGCTCCGGACGCG
ACAGTGACGGAAGGACAGGGTCATCCACAGGCACCGGCCAGCCAGGCGATTCCTCTCAATCTCTCGCCGGAGGAG
GCGGCGCGACGGCGCGACGTGGCTACCAAGCTGCTGAGCGACGCGGGCGTCGACCCGGACACGCTGTCGACGGAG
CAATTCAACATCTTTGCCAACCAGTCGCCCGAGTTGCAAAAGGAGTCTCTTAACATGCTTGTTAAGTACGGCGCT
GAAAGGCTCCGCATTGTACATCCGAGCAATAGGGACAGCTCGGCTTCGGTGCCGCCCAGCGCAGCAGCGCCGACG
GCGCAAGCAGCAACCATTTCGGCCCCTTTGACGGAGCCCGTGGGCGACACGGGAGCAGGTACTTTGACTCCCGCG
ACCAAGACGGGCTCGGGCAAGAAGTTGAGGACGCCCGGCAAGTCGCGCAAAGCGTGCAACCAGTGCAAAGGACGC
AAGGTCAAGTGCCCAAAAGAACGTCCCACGTGCGCCGAGTGCCAGACGCAAGGCATGACGTGTGTATACGCACCG
ACGAAGCCTCGACCGAAGAAGCCCAAGTCGGATGAGTTTGCGCCGCCCGAGTACAACGTCGACGACGAGTCGCAG
ATGCAGCCGGCGGACGCTACGCAGATGACGCTGGAAACTGAAGGAGATAGCACCATGCTCGAGGCTCGAGACGAA
GGCTCGCAGGGGGGAGGAGATGCGGTCCCGGAAGAAGACTTGGATGAAGATGGTCCAGGGGAGGAGGAGCTGCAG
GAAGCAGAAGACGAAGAGGATGAGGAAGAAGCCAAGGGCGCGTCTTCTCCAGAAGAGACGCAGCAGGACGAGACG
AGCTTCTCGGCCTACCCACAGGTGCCCGTCTCCGACATGCTGGCTCCCAGCGTGGACGTTGCTCCCCAGCAGCAG
CAGCAGCAACAGCAGCAGCAGGCAACGTCGACGCCGTACTTCCGATCGGCCTCGGGCCTCGCCTTGCCGCAGCCG
GAGCCGCAACTCATGCCGGCAGCCGAAGAAGACATGATGATGGCTCCCCAGTACCAACCTCCACCGACGACGCAC
CAGAGCCAGACATCAGACGAAGCGATGCAACAGCTCCTCGAGTCTCCCACGCAACCATCCAACAAACCCGTCGTC
TCTCGAAGAAGCCTCCCGACAGCACCAGCCCGTCACGAAGCCGTAGACGGCTGGTCAGGCGTGGCAAACTCCAAC
ATCCCACGCCACAGCGAATCCCACACGTCGTCAACGCAGATGCAAGACGCCATGGCCCTCTCACAAGCAGCTCTC
GAACACCAGCGCCAAACACACAGCATGCCGACGGCGATGCAACCCTCGCACCGATCAACGCTATCTCACCCTGCC
AACGATTCGCGCATGAAGTCGCGGCTGGGTCAACGGCCGCCGACGATGCACGATGGCTACCCGTCTTCGTCGTCC
ATGGGCAACAGTCGCTATCGGTCCACGTCTGGACTGCAGCCCTCGTATAACTCGTTCGGTGGCTATGCTGATGAT
CAGGGCGAGAATAAGATTGGCTATGAGCCCTACACGTTTCAGCGGAACAGCCAGACGGAACAACCTCGCCCTACG
ATCTCCCCGGCATAA
Gene >Ophun1|6113
ATGACGGACGCCAACCAAGACTGGAGGATGGAGGAAAACGATGAGGCTGAGCAGGAAATCGACGAGACTGTGAGC
ATCCCGACCGATATGCCGCCTCACGTTGAGCTGACACTCCTTGCAGAGCTACAAGGCGCAGAAGGATGCCCTTCT
CATAGCTATCGAAGTCAGCGAGTCGATGCTCAAGCCGCCGCCCCCTTCCGACGACAGAAAGGCAGACCGGGACAG
CCCGCTACAAGCAGCGCTGAAATGCGCCCACCACTTGATGGAACAGCGCATCATTTCCAATCCGAGGGACATGAT
TGGCATTCTTCTTTTCGGCACGAGGGAATCCAAGTTTCGATATGCCGATGATGCTTCAGGCGGCCTGGGTTATAC
AAACTGCTATGTCTTTACGGACCTGGACGTTCCCGCCGCAGAGGATGTTAAGGCTGTTCGAGATCTCATCGACGG
GGGCGAAGAAGAGGAGAAGAACATTCTAAAGCCTACAAGTGAGGCTATGTCAATGGCAAACGTCCTCTTCTGCGC
CAATCAGATATTCACCATCAAGGCCGCCAACTTTGGCAGTCGGCGCCTGTTCATCATTACCGATAATGACGATCC
CCATTCTGCAGACAGAGCAGCCGTCTCGTCTGCAGCTGTTCGTGCTAAAGATCTGTACGATCTGGGCGTGTCGAT
TGATCTGTTTCCGATCGCTCGCGACGACTCCAAGTTCGACTTGACCAAGTTCTACGACGTACGTACCTTGCATAC
TTCGTACACGCGCTGCCATCATTGCTTACGTTTCTGACGATTGCTAGGACATTGTCTATGGTGCATCCCTGCCAG
AGGCTGATGGGTTGGCCGCCCCGGTGTCCCGTTCAGGAGATGGGTTGACGTTGCTCAACTCCCTGCTCACCAACA
TTAACTCGAAACAAACACCAAAGCGGGCTTTGTTCTCTAATTTACCATTTGAGATAGCCCCCGGACTTCGTATAT
CCGTGAAAGGCTTCAACATTATGCATCGCCAGACGCCGGCGCGGACTTGCTATGTCTGGCTCGATGGGGAGAGGC
CTCAGATAGCCACCGGCGAGACGACACGGGTTGCAGAGGACAGCACTCGGACGGTGAAGAAGAATGAGGTTAAGA
AGGCTTATAAGTTTGGCGGAGAGTTCGTCTACTTTACTCCGGAGGAGCAAAAGACACTTCGAGACTTTGGCCCTC
CGATTATTCGCATTCTGGGCTTCAAGCCTCGCGCTTCGATACCATTCTGGGCAAGCGTGAAGAAGTCGACCTTCA
TTTACCCCAGCGAGGAAGATTACGTGGGCTCGACTCGTGTCTTCAGCGCGCTATGGCAGAAACTGCTGCAAGACG
ACTTGGTGGCCATGGCGTGGTGCATCGTGCGAGCAAATGCCCAGCCGATTCTCGCAGCCGTCAGGCCATCCAGGG
AACCAGATGTAGAAGGCTCTCCGACACCATTTCTGCCGGCTGGTCTCTGGCTTTACCCGCTCCCTTTCGCAGACG
ATGTCAGGGAGGCGAAGCGGACAGCGGAAGTCTGTCAGGGCTCCGACGAGCTCAAGTCTCGGATGAGAGTCATCG
TGCAGCAGCTGCAGCTGCCCAAGGCCATGTACAACCCTGCAAAATACCCGAACCCGGCCTTGCAGTGGCATTTCA
AAATCCTCAAGGCCCTGGCGCTCGATGAAGAGGTGCCGGAGAAGGCAGAGGACGCGACGGAGCCCAGGTATAAAG
CCATTGGCAAGCGGGTGGGCGGCTATCTTGATGAATGGTCCCACAGGCTGGACCAAGAGACGGGAGTGGTCTCGA
ACTCGAGAAGGGCGAAACGCGAGGCGGAAGATCAAGAGTCAGGTCGTCCCGCGAAGAAGAACCGAGGCAGTCCTG
AAAAGGCGAGCGGGTCGAACATGACAACGCAGCAGCTCCAGATGGCCATTGAGAGCGGTGGAATCACAAAGATGA
CGGTCGCGCAGTTGAGGGACGTGGCAGCAGCTCGGGGATTGAGCACGGCCGGGCGGAAGATGGAGATTGTGGAGA
GGCTGGAACAGTGGTTGGAGGAGGATGCGTGAGGAGTATGAGGAGGCTGAAGGAGCAGAGGATGAAGAAGTATCC
CGTCTAAAGATAGTGACGAGATGGCGCGGCTATTTCGATGAGTTCATCACGGGCGTTGCTCATCAGGGCGTCTGT
CGAGTGGACGCATCAAGGTTACGGTGACAGAAGTGGGGCATCTCGGAAGAGCTTAGGTAAATGCAAGTAAGAGAA
CAGTCAGCTTTCCGGTGACAGGCATATCCGCCGCTAAGTGAATAAAATATCCTCCTATCCACGACAACGAAAGAA
TCTGCAAGTACGGCGACAAACCGTCCCGCTTACTGCATCGACGTCTTCTACCTACTGCGCCGCTGCGCGTTTCCC
TCCCCGCCCAAAGCCGTCGACTATTCAGAGCGCGTCATCGGCCGCCGTTTCGCCCCGGACTCGCCCAGCGCGTGC
GCCCTCGTGACAGCGGCGGCAATGGCCGACTTCCTGGCCAGCTTCAACCTGAGCGGCGACGATGGCGCCCGACCG
CCTTCGGCTTGCGCGTCCATCGATGAGCTGCAACTGCGCCTTCAGGATCTTCTCGCTCACAAGTCGACAGCCACC
CGCGCCGAACACGTGGCTGCCAATCTCGAGATAGGAGCCAATGCTATGCTCAATGTCGGCCTCACGGCGGCAGAG
AACGGCGTGCTGGAGGGCCTCAACAATCTCGATCCCTCCCTCGGCGGCCTCGACTCTTCCAGCTTGGAGACCGAC
GGCGAGCAGATGATGCGCAGCGTTCGCGCGATAGATACGCTCAAGAACCAACCGACCGATGACCCCGTGCTGCAG
AGGGCCGTTGCCAACCTCATCGTCTCGACCGTCAGCAACACCGAGGGCAGTTCGTGGGCTATGAACGACATGTCG
CTCGGTGACCGGGGCTGGAACTTTGTCTACCTTTGCATGGATTCTAGTCGGCAGTGGGATCTGGTCAGCAAAGAA
CAGGCAAAATCCATCATCGGCGAGTATACGCTGAGAGAACCAGACCCGACCCTGATGAGTGTGTCGACCTCATCC
ATCCACACACCCTCGCTTTGTTCGCTAATGTCCTGCTTCGCAGGCAGACCGGCCTACGACTGTCGAGGCTGCGTT
CGCGTCTCCTTCCCTCGTGACAGCCGGTCAATACTGATAAAGTACGATCATACGCCTTTTCACAGGACCGTGGCC
GAGGTAGCCGAATTCTACAAGCCGCCTCCGCGGCAGATGGTGGCTCCCAAAGCCAAGACGCCCAAGAAGACAGGC
TCTGGACGTAAGAAGCGCGACTCGACCAAAGCAAATGGCGAAACCAGCACGCCGAGGAAGCGCAAGAAGACGGCG
TCGCAGCCGCAAGATGCTGACGCGACAGCAATGACGAACGAGCAGCAGCCTCTCGCCGAATTGGGTCAGAACAGC
CAGCCGTTCATTGAGACCGCAGAGGGAGGCTTCGTTGACGGGCTCGCTCCGGACGCGACAGTGACGGAAGGACAG
GGTCATCCACAGGCACCGGCCAGCCAGGCGATTCCTCTCAATCTCTCGCCGGAGGAGGCGGCGCGACGGCGCGAC
GTGGCTACCAAGCTGCTGAGCGACGCGGGCGTCGACCCGGACACGCTGTCGACGGAGCAATTCAACATCTTTGCC
AACCAGTCGCCCGAGTTGCAAAAGGAGTCTCTTAACATGCTTGTTAAGTACGGCGCTGAAAGGCTCCGCATTGTA
CATCCGAGCAATAGGGACAGCTCGGCTTCGGTGCCGCCCAGCGCAGCAGCGCCGACGGCGCAAGCAGCAACCATT
TCGGCCCCTTTGACGGAGCCCGTGGGCGACACGGGAGCAGGTACTTTGACTCCCGCGACCAAGACGGGCTCGGGC
AAGAAGTTGAGGACGCCCGGCAAGTCGCGCAAAGCGTGCAACCAGTGCAAAGGACGCAAGGTCAAGGTATGTGCC
CAGAATGTGTCTTCGTCTTTCCTCGATCCTAACAGAGCTCTCATCAGTGCCCAAAAGAACGTCCCACGTGCGCCG
AGTGCCAGACGCAAGGCATGACGTGTGTATACGCACCGACGAAGCCTCGACCGAAGAAGCCCAAGTCGGATGAGT
TTGCGCCGCCCGAGTACAACGTCGACGACGAGTCGCAGATGCAGCCGGCGGACGCTACGCAGATGACGCTGGAAA
CTGAAGGAGATAGCACCATGCTCGAGGCTCGAGACGAAGGCTCGCAGGGGGGAGGAGATGCGGTCCCGGAAGAAG
ACTTGGATGAAGATGGTCCAGGGGAGGAGGAGCTGCAGGAAGCAGAAGACGAAGAGGATGAGGAAGAAGCCAAGG
GCGCGTCTTCTCCAGAAGAGACGCAGCAGGACGAGACGAGCTTCTCGGCCTACCCACAGGTGCCCGTCTCCGACA
TGCTGGCTCCCAGCGTGGACGTTGCTCCCCAGCAGCAGCAGCAGCAACAGCAGCAGCAGGCAACGTCGACGCCGT
ACTTCCGATCGGCCTCGGGCCTCGCCTTGCCGCAGCCGGAGCCGCAACTCATGCCGGCAGCCGAAGAAGACATGA
TGATGGCTCCCCAGTACCAACCTCCACCGACGACGCACCAGAGCCAGACATCAGACGAAGCGATGCAACAGCTCC
TCGAGTCTCCCACGCAACCATCCAACAAACCCGTCGTCTCTCGAAGAAGCCTCCCGACAGCACCAGCCCGTCACG
AAGCCGTAGACGGCTGGTCAGGCGTGGCAAACTCCAACATCCCACGCCACAGCGAATCCCACACGTCGTCAACGC
AGATGCAAGACGCCATGGCCCTCTCACAAGCAGCTCTCGAACACCAGCGCCAAACACACAGCATGCCGACGGCGA
TGCAACCCTCGCACCGATCAACGCTATCTCACCCTGCCAACGATTCGCGCATGAAGTCGCGGCTGGGTCAACGGC
CGCCGACGATGCACGATGGCTACCCGTCTTCGTCGTCCATGGGCAACAGTCGCTATCGGTCCACGTCTGGACTGC
AGCCCTCGTATAACTCGTTCGGTGGCTATGCTGATGATCAGGGCGAGAATAAGATTGGCTATGAGCCCTACACGT
TTCAGCGGAACAGCCAGACGGGTTCGTCCTTTTCAGGCTACGATTACAGTCGCGGCCAGCCTTCTTCAACGACGA
CGGTTGAGAACCCCGGCTCCAACACCATGACCTCTTCGTACCAACCTTCCAGCAACGACCATCACAACCCCAGCT
CTAACCTCGGCCTCTCGGACGCCCCCTCAAACAACATGTCCACCTCTCGCGCCCACCACAACGTCCCCAGCAGAA
CAACCTCGCCCTACGATCTCCCCGGCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail