Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6112
Gene name
LocationContig_645:3117..4484
Strand-
Gene length (bp)1367
Transcript length (bp)1260
Coding sequence length (bp)1260
Protein length (aa) 420

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00762 Ferrochelatase Ferrochelatase 1.8E-100 48 377

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P16622|HEMH_YEAST Ferrochelatase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM15 PE=1 SV=1 45 390 2.0E-143
sp|O57478|HEMH_XENLA Ferrochelatase, mitochondrial OS=Xenopus laevis GN=fech PE=1 SV=1 45 413 2.0E-142
sp|P22600|HEMH_BOVIN Ferrochelatase, mitochondrial OS=Bos taurus GN=FECH PE=1 SV=3 36 411 4.0E-142
sp|P22315|HEMH_MOUSE Ferrochelatase, mitochondrial OS=Mus musculus GN=Fech PE=1 SV=2 18 411 2.0E-138
sp|O59786|HEMH_SCHPO Ferrochelatase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hem15 PE=3 SV=1 34 407 5.0E-133
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P16622|HEMH_YEAST Ferrochelatase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM15 PE=1 SV=1 45 390 2.0E-143
sp|O57478|HEMH_XENLA Ferrochelatase, mitochondrial OS=Xenopus laevis GN=fech PE=1 SV=1 45 413 2.0E-142
sp|P22600|HEMH_BOVIN Ferrochelatase, mitochondrial OS=Bos taurus GN=FECH PE=1 SV=3 36 411 4.0E-142
sp|P22315|HEMH_MOUSE Ferrochelatase, mitochondrial OS=Mus musculus GN=Fech PE=1 SV=2 18 411 2.0E-138
sp|O59786|HEMH_SCHPO Ferrochelatase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hem15 PE=3 SV=1 34 407 5.0E-133
sp|Q3YA36|HEMH_PANTR Ferrochelatase, mitochondrial OS=Pan troglodytes GN=FECH PE=2 SV=1 45 411 7.0E-132
sp|P22830|HEMH_HUMAN Ferrochelatase, mitochondrial OS=Homo sapiens GN=FECH PE=1 SV=2 45 411 1.0E-131
sp|O42479|HEMH_CHICK Ferrochelatase, mitochondrial OS=Gallus gallus GN=FECH PE=1 SV=1 45 411 7.0E-128
sp|Q9V9S8|HEMH_DROME Ferrochelatase, mitochondrial OS=Drosophila melanogaster GN=FeCh PE=2 SV=1 38 407 2.0E-118
sp|Q54IA8|HEMH_DICDI Ferrochelatase, mitochondrial OS=Dictyostelium discoideum GN=hemH PE=3 SV=1 45 401 4.0E-105
sp|B5EJ44|HEMH_GEOBB Ferrochelatase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=hemH PE=3 SV=1 42 376 3.0E-67
sp|B9M326|HEMH_GEODF Ferrochelatase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=hemH PE=3 SV=1 48 376 8.0E-66
sp|C6E7U2|HEMH_GEOSM Ferrochelatase OS=Geobacter sp. (strain M21) GN=hemH PE=3 SV=1 42 376 1.0E-65
sp|A1ASJ7|HEMH_PELPD Ferrochelatase OS=Pelobacter propionicus (strain DSM 2379) GN=hemH PE=3 SV=1 48 375 1.0E-62
sp|A5GDG7|HEMH_GEOUR Ferrochelatase OS=Geobacter uraniireducens (strain Rf4) GN=hemH PE=3 SV=1 48 374 3.0E-61
sp|Q747F5|HEMH_GEOSL Ferrochelatase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=hemH PE=3 SV=1 48 375 2.0E-59
sp|Q39ZQ5|HEMH_GEOMG Ferrochelatase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=hemH PE=3 SV=1 48 375 5.0E-59
sp|B2J9P0|HEMH_NOSP7 Ferrochelatase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=hemH PE=3 SV=1 46 374 6.0E-58
sp|P54225|HEMH_SYNY3 Ferrochelatase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hemH PE=3 SV=1 46 378 1.0E-57
sp|Q5N2B2|HEMH_SYNP6 Ferrochelatase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=hemH PE=3 SV=1 46 378 1.0E-56
sp|Q31S00|HEMH_SYNE7 Ferrochelatase OS=Synechococcus elongatus (strain PCC 7942) GN=hemH PE=3 SV=1 46 378 1.0E-56
sp|Q8YQR8|HEMH_NOSS1 Ferrochelatase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hemH PE=3 SV=1 46 374 2.0E-56
sp|B7KGB9|HEMH_CYAP7 Ferrochelatase OS=Cyanothece sp. (strain PCC 7424) GN=hemH PE=3 SV=1 46 378 3.0E-56
sp|Q3MCT9|HEMH_ANAVT Ferrochelatase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hemH PE=3 SV=1 46 374 2.0E-55
sp|A5GS98|HEMH_SYNR3 Ferrochelatase OS=Synechococcus sp. (strain RCC307) GN=hemH PE=3 SV=1 48 378 1.0E-54
sp|Q10WR6|HEMH_TRIEI Ferrochelatase OS=Trichodesmium erythraeum (strain IMS101) GN=hemH PE=3 SV=1 48 378 1.0E-54
sp|A2Y3Q5|HEMH_ORYSI Ferrochelatase-2, chloroplastic OS=Oryza sativa subsp. indica GN=HEMH PE=2 SV=2 20 372 4.0E-54
sp|Q0DIV0|HEMH2_ORYSJ Ferrochelatase-2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os05g0361200 PE=2 SV=1 20 372 4.0E-54
sp|B8HK77|HEMH_CYAP4 Ferrochelatase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=hemH PE=3 SV=1 46 388 4.0E-54
sp|Q7NMC7|HEMH_GLOVI Ferrochelatase OS=Gloeobacter violaceus (strain PCC 7421) GN=hemH PE=3 SV=1 48 378 5.0E-54
sp|B1XL79|HEMH_SYNP2 Ferrochelatase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=hemH PE=3 SV=1 46 389 2.0E-53
sp|B7K399|HEMH_CYAP8 Ferrochelatase OS=Cyanothece sp. (strain PCC 8801) GN=hemH PE=3 SV=1 48 378 2.0E-53
sp|P42043|HEMH1_ARATH Ferrochelatase-1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=HEM15 PE=2 SV=1 50 385 2.0E-53
sp|P42044|HEMH_CUCSA Ferrochelatase-2, chloroplastic OS=Cucumis sativus GN=HEMH PE=2 SV=1 48 385 3.0E-53
sp|O04921|HEMH2_ARATH Ferrochelatase-2, chloroplastic OS=Arabidopsis thaliana GN=At2g30390 PE=1 SV=1 50 372 4.0E-53
sp|Q7V6C6|HEMH_PROMM Ferrochelatase OS=Prochlorococcus marinus (strain MIT 9313) GN=hemH PE=3 SV=1 48 378 5.0E-53
sp|A2C7Q7|HEMH_PROM3 Ferrochelatase OS=Prochlorococcus marinus (strain MIT 9303) GN=hemH PE=3 SV=1 48 378 1.0E-52
sp|Q6APB0|HEMH_DESPS Ferrochelatase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=hemH PE=3 SV=1 47 341 4.0E-52
sp|Q7VD58|HEMH_PROMA Ferrochelatase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=hemH PE=3 SV=1 48 393 6.0E-52
sp|Q7U5G0|HEMH_SYNPX Ferrochelatase OS=Synechococcus sp. (strain WH8102) GN=hemH PE=3 SV=1 48 378 1.0E-51
sp|A5GJF5|HEMH_SYNPW Ferrochelatase OS=Synechococcus sp. (strain WH7803) GN=hemH PE=3 SV=1 48 378 1.0E-51
sp|B0JRN7|HEMH_MICAN Ferrochelatase OS=Microcystis aeruginosa (strain NIES-843) GN=hemH PE=3 SV=1 46 374 5.0E-51
sp|A2C0Y4|HEMH_PROM1 Ferrochelatase OS=Prochlorococcus marinus (strain NATL1A) GN=hemH PE=3 SV=1 48 393 5.0E-51
sp|Q8DGU6|HEMH_THEEB Ferrochelatase OS=Thermosynechococcus elongatus (strain BP-1) GN=hemH PE=3 SV=2 48 378 6.0E-51
sp|Q46GQ1|HEMH_PROMT Ferrochelatase OS=Prochlorococcus marinus (strain NATL2A) GN=hemH PE=3 SV=1 48 393 7.0E-51
sp|Q2JHZ4|HEMH_SYNJB Ferrochelatase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=hemH PE=3 SV=1 48 380 1.0E-50
sp|Q3ALP2|HEMH_SYNSC Ferrochelatase OS=Synechococcus sp. (strain CC9605) GN=hemH PE=3 SV=1 48 378 1.0E-50
sp|B2V955|HEMH_SULSY Ferrochelatase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=hemH PE=3 SV=1 44 374 2.0E-50
sp|Q0I8L9|HEMH_SYNS3 Ferrochelatase OS=Synechococcus sp. (strain CC9311) GN=hemH PE=3 SV=1 48 378 4.0E-50
sp|A9BEE9|HEMH_PROM4 Ferrochelatase OS=Prochlorococcus marinus (strain MIT 9211) GN=hemH PE=3 SV=1 48 393 1.0E-48
sp|Q69TB1|HEMH1_ORYSJ Ferrochelatase-1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os09g0297000 PE=2 SV=1 40 383 2.0E-48
sp|Q2JVK5|HEMH_SYNJA Ferrochelatase OS=Synechococcus sp. (strain JA-3-3Ab) GN=hemH PE=3 SV=1 48 380 2.0E-48
sp|P42045|HEMH_HORVU Ferrochelatase-2, chloroplastic OS=Hordeum vulgare GN=HEMH PE=2 SV=1 48 383 7.0E-48
sp|A2BVI7|HEMH_PROM5 Ferrochelatase OS=Prochlorococcus marinus (strain MIT 9515) GN=hemH PE=3 SV=1 49 378 2.0E-47
sp|A3PBP9|HEMH_PROM0 Ferrochelatase OS=Prochlorococcus marinus (strain MIT 9301) GN=hemH PE=3 SV=1 49 378 8.0E-46
sp|A2BQ06|HEMH_PROMS Ferrochelatase OS=Prochlorococcus marinus (strain AS9601) GN=hemH PE=3 SV=1 49 383 2.0E-45
sp|O67083|HEMH_AQUAE Ferrochelatase OS=Aquifex aeolicus (strain VF5) GN=hemH PE=3 SV=1 50 378 7.0E-45
sp|Q1RGK5|HEMH_RICBR Ferrochelatase OS=Rickettsia bellii (strain RML369-C) GN=hemH PE=3 SV=1 44 373 9.0E-45
sp|A8GYD7|HEMH_RICB8 Ferrochelatase OS=Rickettsia bellii (strain OSU 85-389) GN=hemH PE=3 SV=1 44 373 9.0E-45
sp|A8G3P0|HEMH_PROM2 Ferrochelatase OS=Prochlorococcus marinus (strain MIT 9215) GN=hemH PE=3 SV=1 49 378 1.0E-44
sp|Q7V2F5|HEMH_PROMP Ferrochelatase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=hemH PE=3 SV=1 48 378 2.0E-44
sp|Q31C09|HEMH_PROM9 Ferrochelatase OS=Prochlorococcus marinus (strain MIT 9312) GN=hemH PE=3 SV=1 50 383 5.0E-44
sp|Q4UJN9|HEMH_RICFE Ferrochelatase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=hemH PE=3 SV=2 45 394 5.0E-42
sp|Q73FY6|HEMH_WOLPM Ferrochelatase OS=Wolbachia pipientis wMel GN=hemH PE=3 SV=1 49 374 1.0E-41
sp|Q92FV4|HEMH_RICCN Ferrochelatase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=hemH PE=3 SV=2 45 394 1.0E-41
sp|C0R4L0|HEMH_WOLWR Ferrochelatase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=hemH PE=3 SV=1 49 374 2.0E-41
sp|Q68VM9|HEMH_RICTY Ferrochelatase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=hemH PE=3 SV=2 45 401 7.0E-40
sp|Q9ZC84|HEMH_RICPR Ferrochelatase OS=Rickettsia prowazekii (strain Madrid E) GN=hemH PE=3 SV=2 49 401 1.0E-39
sp|B3CLU1|HEMH_WOLPP Ferrochelatase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=hemH PE=3 SV=1 49 377 2.0E-39
sp|Q4FNS1|HEMH_PELUB Ferrochelatase OS=Pelagibacter ubique (strain HTCC1062) GN=hemH PE=3 SV=1 49 373 4.0E-39
sp|P57777|HEMH_CAUCR Ferrochelatase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hemH PE=1 SV=1 49 400 1.0E-37
sp|B8GW40|HEMH_CAUCN Ferrochelatase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=hemH PE=3 SV=1 49 400 1.0E-37
sp|Q9RV98|HEMH_DEIRA Ferrochelatase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hemH PE=3 SV=1 41 373 1.0E-36
sp|A8F0B2|HEMH_RICCK Ferrochelatase OS=Rickettsia canadensis (strain McKiel) GN=hemH PE=3 SV=1 45 394 2.0E-36
sp|Q5GRR7|HEMH_WOLTR Ferrochelatase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=hemH PE=3 SV=1 49 377 2.0E-36
sp|A6Q2Y9|HEMH_NITSB Ferrochelatase OS=Nitratiruptor sp. (strain SB155-2) GN=hemH PE=3 SV=1 49 373 4.0E-36
sp|B2UUI4|HEMH_HELPS Ferrochelatase OS=Helicobacter pylori (strain Shi470) GN=hemH PE=3 SV=1 43 341 4.0E-35
sp|Q9ZKD4|HEMH_HELPJ Ferrochelatase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=hemH PE=3 SV=1 39 341 4.0E-35
sp|B5Z875|HEMH_HELPG Ferrochelatase OS=Helicobacter pylori (strain G27) GN=hemH PE=3 SV=1 43 341 5.0E-35
sp|Q1CSI9|HEMH_HELPH Ferrochelatase OS=Helicobacter pylori (strain HPAG1) GN=hemH PE=3 SV=1 43 341 8.0E-35
sp|B6JMR9|HEMH_HELP2 Ferrochelatase OS=Helicobacter pylori (strain P12) GN=hemH PE=3 SV=1 43 341 1.0E-34
sp|Q30S35|HEMH_SULDN Ferrochelatase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=hemH PE=3 SV=1 49 373 2.0E-34
sp|P56107|HEMH_HELPY Ferrochelatase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=hemH PE=3 SV=1 43 341 3.0E-34
sp|B4RD10|HEMH_PHEZH Ferrochelatase OS=Phenylobacterium zucineum (strain HLK1) GN=hemH PE=3 SV=1 49 374 5.0E-34
sp|Q17YG0|HEMH_HELAH Ferrochelatase OS=Helicobacter acinonychis (strain Sheeba) GN=hemH PE=3 SV=1 40 341 6.0E-34
sp|Q0BWA5|HEMH_HYPNA Ferrochelatase OS=Hyphomonas neptunium (strain ATCC 15444) GN=hemH PE=3 SV=1 49 370 2.0E-33
sp|Q7M7P9|HEMH_WOLSU Ferrochelatase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=hemH PE=3 SV=1 49 373 5.0E-31
sp|Q252Z7|HEMH_CHLFF Ferrochelatase OS=Chlamydophila felis (strain Fe/C-56) GN=hemH PE=3 SV=1 54 345 8.0E-30
sp|Q8ERX9|HEMH_OCEIH Ferrochelatase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=hemH PE=3 SV=1 99 374 9.0E-30
sp|Q5L6X6|HEMH_CHLAB Ferrochelatase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=hemH PE=3 SV=1 54 376 1.0E-29
sp|Q8GCV0|HEMH_LEPBI Ferrochelatase OS=Leptospira biflexa GN=hemH PE=3 SV=1 50 372 2.0E-29
sp|Q824K8|HEMH_CHLCV Ferrochelatase OS=Chlamydophila caviae (strain GPIC) GN=hemH PE=3 SV=1 48 376 2.0E-29
sp|B0SNJ9|HEMH_LEPBP Ferrochelatase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=hemH PE=3 SV=1 50 372 4.0E-29
sp|B0SF60|HEMH_LEPBA Ferrochelatase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=hemH PE=3 SV=1 50 372 4.0E-29
sp|A9B546|HEMH_HERA2 Ferrochelatase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=hemH PE=3 SV=1 48 374 5.0E-29
sp|Q04X34|HEMH_LEPBL Ferrochelatase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=hemH PE=3 SV=1 50 400 1.0E-28
sp|A8FBM6|HEMH_BACP2 Ferrochelatase OS=Bacillus pumilus (strain SAFR-032) GN=hemH PE=3 SV=1 99 378 2.0E-28
sp|Q5L283|HEMH_GEOKA Ferrochelatase OS=Geobacillus kaustophilus (strain HTA426) GN=hemH PE=3 SV=1 83 374 2.0E-28
sp|Q7VHH1|HEMH_HELHP Ferrochelatase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=hemH PE=3 SV=1 55 378 4.0E-28
sp|Q04NU7|HEMH_LEPBJ Ferrochelatase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=hemH PE=3 SV=1 50 400 5.0E-28
sp|Q3KLL2|HEMH_CHLTA Ferrochelatase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=hemH PE=3 SV=1 54 376 8.0E-28
sp|O84492|HEMH_CHLTR Ferrochelatase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=hemH PE=3 SV=1 54 376 2.0E-27
sp|A4IKU8|HEMH_GEOTN Ferrochelatase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=hemH PE=3 SV=1 83 378 3.0E-27
sp|C5D6M6|HEMH_GEOSW Ferrochelatase OS=Geobacillus sp. (strain WCH70) GN=hemH PE=3 SV=1 99 374 3.0E-27
sp|Q9PI08|HEMH_CAMJE Ferrochelatase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=hemH PE=3 SV=1 50 340 3.0E-27
sp|B0BCC3|HEMH_CHLTB Ferrochelatase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=hemH PE=3 SV=1 54 376 3.0E-27
sp|B0B858|HEMH_CHLT2 Ferrochelatase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=hemH PE=3 SV=1 54 376 3.0E-27
sp|A7H4N6|HEMH_CAMJD Ferrochelatase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=hemH PE=3 SV=1 50 340 3.0E-27
sp|A8FKS9|HEMH_CAMJ8 Ferrochelatase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=hemH PE=3 SV=1 50 340 4.0E-27
sp|B7GF12|HEMH_ANOFW Ferrochelatase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=hemH PE=3 SV=1 99 378 5.0E-27
sp|Q5HVR0|HEMH_CAMJR Ferrochelatase OS=Campylobacter jejuni (strain RM1221) GN=hemH PE=3 SV=1 50 340 1.0E-26
sp|A1VYL5|HEMH_CAMJJ Ferrochelatase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=hemH PE=3 SV=1 50 340 2.0E-26
sp|A4G8D5|HEMH_HERAR Ferrochelatase OS=Herminiimonas arsenicoxydans GN=hemH PE=3 SV=1 33 379 5.0E-26
sp|Q6MAW8|HEMH_PARUW Ferrochelatase OS=Protochlamydia amoebophila (strain UWE25) GN=hemH PE=3 SV=1 48 378 7.0E-26
sp|P32396|HEMH_BACSU Ferrochelatase OS=Bacillus subtilis (strain 168) GN=hemH PE=1 SV=1 99 378 1.0E-25
sp|Q5WHT1|HEMH_BACSK Ferrochelatase OS=Bacillus clausii (strain KSM-K16) GN=hemH PE=3 SV=1 99 378 2.0E-25
sp|Q87RH3|HEMH_VIBPA Ferrochelatase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hemH PE=3 SV=1 42 378 2.0E-24
sp|P43868|HEMH_HAEIN Ferrochelatase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hemH PE=3 SV=1 42 343 2.0E-24
sp|Q9Z7V1|HEMH_CHLPN Ferrochelatase OS=Chlamydia pneumoniae GN=hemH PE=3 SV=1 49 375 2.0E-24
sp|Q9PJQ6|HEMH_CHLMU Ferrochelatase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=hemH PE=3 SV=1 48 376 4.0E-24
sp|Q47HJ6|HEMH_DECAR Ferrochelatase OS=Dechloromonas aromatica (strain RCB) GN=hemH PE=3 SV=1 36 378 5.0E-24
sp|Q9KDK9|HEMH_BACHD Ferrochelatase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hemH PE=3 SV=1 99 378 9.0E-24
sp|Q81U22|HEMH1_BACAN Ferrochelatase 1 OS=Bacillus anthracis GN=hemH1 PE=1 SV=1 99 374 2.0E-23
sp|Q6HM97|HEMH1_BACHK Ferrochelatase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hemH1 PE=3 SV=1 99 374 3.0E-23
sp|Q63ES4|HEMH1_BACCZ Ferrochelatase 1 OS=Bacillus cereus (strain ZK / E33L) GN=hemH1 PE=3 SV=1 99 374 5.0E-23
sp|Q71XF4|HEMH_LISMF Ferrochelatase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=hemH PE=3 SV=1 99 370 6.0E-23
sp|Q929G2|HEMH_LISIN Ferrochelatase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=hemH PE=3 SV=1 99 370 7.0E-23
sp|A9MDJ3|HEMH_BRUC2 Ferrochelatase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=hemH PE=3 SV=1 48 379 7.0E-23
sp|A9VI99|HEMH_BACWK Ferrochelatase OS=Bacillus weihenstephanensis (strain KBAB4) GN=hemH PE=3 SV=1 102 374 8.0E-23
sp|Q81GW5|HEMH1_BACCR Ferrochelatase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hemH1 PE=3 SV=2 99 374 8.0E-23
sp|Q73C98|HEMH1_BACC1 Ferrochelatase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hemH1 PE=3 SV=1 99 374 8.0E-23
sp|Q8XW32|HEMH_RALSO Ferrochelatase OS=Ralstonia solanacearum (strain GMI1000) GN=hemH PE=3 SV=1 36 378 1.0E-22
sp|P0A3D7|HEMH_BRUSU Ferrochelatase OS=Brucella suis biovar 1 (strain 1330) GN=hemH PE=3 SV=1 48 379 2.0E-22
sp|A9WXE2|HEMH_BRUSI Ferrochelatase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=hemH PE=3 SV=1 48 379 2.0E-22
sp|A5VTJ7|HEMH_BRUO2 Ferrochelatase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=hemH PE=3 SV=1 48 379 2.0E-22
sp|P0A3D6|HEMH_BRUME Ferrochelatase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=hemH PE=3 SV=1 48 379 2.0E-22
sp|C0RK28|HEMH_BRUMB Ferrochelatase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=hemH PE=3 SV=1 48 379 2.0E-22
sp|A6X6W2|HEMH_OCHA4 Ferrochelatase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=hemH PE=3 SV=1 38 347 2.0E-22
sp|Q833G5|HEMH_ENTFA Ferrochelatase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=hemH PE=3 SV=1 48 373 2.0E-22
sp|P0A3D8|HEMH_BRUAB Ferrochelatase OS=Brucella abortus biovar 1 (strain 9-941) GN=hemH PE=3 SV=2 48 379 5.0E-22
sp|Q2YIS9|HEMH_BRUA2 Ferrochelatase OS=Brucella abortus (strain 2308) GN=hemH PE=3 SV=1 48 379 5.0E-22
sp|B2SCP3|HEMH_BRUA1 Ferrochelatase OS=Brucella abortus (strain S19) GN=hemH PE=3 SV=1 48 379 5.0E-22
sp|Q4QLD6|HEMH_HAEI8 Ferrochelatase OS=Haemophilus influenzae (strain 86-028NP) GN=hemH PE=3 SV=1 42 343 5.0E-22
sp|Q6GFM4|HEMH_STAAR Ferrochelatase OS=Staphylococcus aureus (strain MRSA252) GN=hemH PE=3 SV=1 92 372 5.0E-22
sp|Q67T48|HEMH_SYMTH Ferrochelatase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=hemH PE=3 SV=1 48 378 5.0E-22
sp|Q8Y565|HEMH_LISMO Ferrochelatase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=hemH PE=3 SV=1 99 370 6.0E-22
sp|P64126|HEMH_STAAW Ferrochelatase OS=Staphylococcus aureus (strain MW2) GN=hemH PE=3 SV=1 92 372 6.0E-22
sp|Q6G8A3|HEMH_STAAS Ferrochelatase OS=Staphylococcus aureus (strain MSSA476) GN=hemH PE=3 SV=1 92 372 6.0E-22
sp|P64125|HEMH_STAAN Ferrochelatase OS=Staphylococcus aureus (strain N315) GN=hemH PE=1 SV=1 92 372 6.0E-22
sp|P64124|HEMH_STAAM Ferrochelatase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hemH PE=3 SV=1 92 372 6.0E-22
sp|Q5HEU3|HEMH_STAAC Ferrochelatase OS=Staphylococcus aureus (strain COL) GN=hemH PE=3 SV=1 92 372 6.0E-22
sp|Q8EBZ7|HEMH2_SHEON Ferrochelatase 2 OS=Shewanella oneidensis (strain MR-1) GN=hemH2 PE=3 SV=1 43 378 6.0E-22
sp|A3N3M9|HEMH_ACTP2 Ferrochelatase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=hemH PE=3 SV=1 50 373 6.0E-22
sp|A5UCU6|HEMH_HAEIE Ferrochelatase OS=Haemophilus influenzae (strain PittEE) GN=hemH PE=3 SV=1 42 343 7.0E-22
sp|C5BD17|HEMH_EDWI9 Ferrochelatase OS=Edwardsiella ictaluri (strain 93-146) GN=hemH PE=3 SV=1 50 350 7.0E-22
sp|A8GAV7|HEMH_SERP5 Ferrochelatase OS=Serratia proteamaculans (strain 568) GN=hemH PE=3 SV=1 50 374 1.0E-21
sp|Q65SV7|HEMH_MANSM Ferrochelatase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=hemH PE=3 SV=1 48 373 1.0E-21
sp|B0BTL7|HEMH_ACTPJ Ferrochelatase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=hemH PE=3 SV=1 50 373 2.0E-21
sp|A6T228|HEMH_JANMA Ferrochelatase OS=Janthinobacterium sp. (strain Marseille) GN=hemH PE=3 SV=1 33 379 3.0E-21
sp|Q82UK8|HEMH_NITEU Ferrochelatase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=hemH PE=3 SV=1 43 378 4.0E-21
sp|Q72L32|HEMH_THET2 Ferrochelatase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hemH PE=3 SV=1 98 373 5.0E-21
sp|B3H307|HEMH_ACTP7 Ferrochelatase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=hemH PE=3 SV=1 50 373 5.0E-21
sp|Q8CNS1|HEMH_STAES Ferrochelatase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hemH PE=3 SV=1 99 378 6.0E-21
sp|Q8D226|HEMH_WIGBR Ferrochelatase OS=Wigglesworthia glossinidia brevipalpis GN=hemH PE=3 SV=1 45 378 9.0E-21
sp|A0RNU4|HEMH_CAMFF Ferrochelatase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=hemH PE=3 SV=1 49 371 1.0E-20
sp|Q11ES4|HEMH_CHESB Ferrochelatase OS=Chelativorans sp. (strain BNC1) GN=hemH PE=3 SV=1 31 340 1.0E-20
sp|Q6D7Z4|HEMH_PECAS Ferrochelatase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=hemH PE=3 SV=1 50 374 1.0E-20
sp|Q5HNA5|HEMH_STAEQ Ferrochelatase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=hemH PE=3 SV=1 99 378 1.0E-20
sp|B3PZU8|HEMH_RHIE6 Ferrochelatase OS=Rhizobium etli (strain CIAT 652) GN=hemH PE=3 SV=1 46 378 1.0E-20
sp|B1JHN0|HEMH_YERPY Ferrochelatase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=hemH PE=3 SV=1 42 343 3.0E-20
sp|Q05338|HEMH_YERPS Ferrochelatase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=hemH PE=3 SV=2 42 343 3.0E-20
sp|A4TPA3|HEMH_YERPP Ferrochelatase OS=Yersinia pestis (strain Pestoides F) GN=hemH PE=3 SV=1 42 343 3.0E-20
sp|Q1CL26|HEMH_YERPN Ferrochelatase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=hemH PE=3 SV=1 42 343 3.0E-20
sp|A9R0Q8|HEMH_YERPG Ferrochelatase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=hemH PE=3 SV=1 42 343 3.0E-20
sp|Q8ZC98|HEMH_YERPE Ferrochelatase OS=Yersinia pestis GN=hemH PE=3 SV=1 42 343 3.0E-20
sp|B2K6Z7|HEMH_YERPB Ferrochelatase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=hemH PE=3 SV=1 42 343 3.0E-20
sp|Q1C4Q0|HEMH_YERPA Ferrochelatase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=hemH PE=3 SV=1 42 343 3.0E-20
sp|A7FL85|HEMH_YERP3 Ferrochelatase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=hemH PE=3 SV=1 42 343 3.0E-20
sp|Q2K4C4|HEMH_RHIEC Ferrochelatase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=hemH PE=3 SV=1 46 378 4.0E-20
sp|A5WH56|HEMH_PSYWF Ferrochelatase OS=Psychrobacter sp. (strain PRwf-1) GN=hemH PE=3 SV=1 49 343 6.0E-20
sp|P43413|HEMH_YEREN Ferrochelatase OS=Yersinia enterocolitica GN=hemH PE=3 SV=2 50 378 7.0E-20
sp|Q8EFF4|HEMH1_SHEON Ferrochelatase 1 OS=Shewanella oneidensis (strain MR-1) GN=hemH1 PE=3 SV=2 42 340 8.0E-20
sp|Q145F5|HEMH_BURXL Ferrochelatase OS=Burkholderia xenovorans (strain LB400) GN=hemH PE=3 SV=1 38 378 9.0E-20
sp|A0K4S2|HEMH_BURCH Ferrochelatase OS=Burkholderia cenocepacia (strain HI2424) GN=hemH PE=3 SV=1 40 378 9.0E-20
sp|A1JNA4|HEMH_YERE8 Ferrochelatase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=hemH PE=3 SV=1 50 378 1.0E-19
sp|Q0KCJ6|HEMH_CUPNH Ferrochelatase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hemH PE=3 SV=1 48 378 1.0E-19
sp|B9JS40|HEMH_AGRVS Ferrochelatase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=hemH PE=3 SV=1 29 378 1.0E-19
sp|B2UBQ0|HEMH_RALPJ Ferrochelatase OS=Ralstonia pickettii (strain 12J) GN=hemH PE=3 SV=1 43 378 1.0E-19
sp|B4SNS0|HEMH_STRM5 Ferrochelatase OS=Stenotrophomonas maltophilia (strain R551-3) GN=hemH PE=3 SV=1 48 364 2.0E-19
sp|Q9KTB6|HEMH_VIBCH Ferrochelatase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hemH PE=3 SV=2 42 376 2.0E-19
sp|P28602|HEMH_BRADU Ferrochelatase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hemH PE=3 SV=3 30 343 2.0E-19
sp|B3R447|HEMH_CUPTR Ferrochelatase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=hemH PE=3 SV=1 48 378 2.0E-19
sp|B5Y0N2|HEMH_KLEP3 Ferrochelatase OS=Klebsiella pneumoniae (strain 342) GN=hemH PE=3 SV=1 48 373 3.0E-19
sp|Q8NQA1|HEMH_CORGL Ferrochelatase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=hemH PE=3 SV=1 40 373 4.0E-19
sp|Q473L7|HEMH_CUPPJ Ferrochelatase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=hemH PE=3 SV=1 48 378 6.0E-19
sp|B2SXB8|HEMH_BURPP Ferrochelatase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=hemH PE=3 SV=1 38 378 7.0E-19
sp|B5ZPG3|HEMH_RHILW Ferrochelatase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=hemH PE=3 SV=1 46 343 7.0E-19
sp|Q12BZ9|HEMH_POLSJ Ferrochelatase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=hemH PE=3 SV=1 48 378 9.0E-19
sp|Q98H61|HEMH_RHILO Ferrochelatase OS=Rhizobium loti (strain MAFF303099) GN=hemH PE=3 SV=1 46 343 1.0E-18
sp|A6VXF8|HEMH_MARMS Ferrochelatase OS=Marinomonas sp. (strain MWYL1) GN=hemH PE=3 SV=1 42 344 1.0E-18
sp|Q4FUR3|HEMH_PSYA2 Ferrochelatase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=hemH PE=3 SV=1 49 340 1.0E-18
sp|A0KL51|HEMH_AERHH Ferrochelatase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=hemH PE=3 SV=1 48 340 2.0E-18
sp|Q1LPN9|HEMH_CUPMC Ferrochelatase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=hemH PE=3 SV=1 33 378 2.0E-18
sp|A7MNM8|HEMH_CROS8 Ferrochelatase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=hemH PE=3 SV=1 48 374 2.0E-18
sp|A1A8E1|HEMH_ECOK1 Ferrochelatase OS=Escherichia coli O1:K1 / APEC GN=hemH PE=3 SV=1 48 377 2.0E-18
sp|B7MDZ7|HEMH_ECO45 Ferrochelatase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=hemH PE=3 SV=1 48 377 2.0E-18
sp|A7ZE60|HEMH_CAMC1 Ferrochelatase OS=Campylobacter concisus (strain 13826) GN=hemH PE=3 SV=1 49 340 2.0E-18
sp|B1LJN3|HEMH_ECOSM Ferrochelatase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=hemH PE=3 SV=1 48 377 3.0E-18
sp|Q607T4|HEMH_METCA Ferrochelatase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=hemH PE=3 SV=1 48 378 3.0E-18
sp|A1T8R1|HEMH_MYCVP Ferrochelatase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=hemH PE=3 SV=1 49 397 3.0E-18
sp|Q1QDQ5|HEMH_PSYCK Ferrochelatase OS=Psychrobacter cryohalolentis (strain K5) GN=hemH PE=3 SV=1 48 340 3.0E-18
sp|Q1RF60|HEMH_ECOUT Ferrochelatase OS=Escherichia coli (strain UTI89 / UPEC) GN=hemH PE=3 SV=1 48 377 3.0E-18
sp|Q8FK83|HEMH_ECOL6 Ferrochelatase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hemH PE=3 SV=1 48 377 3.0E-18
sp|Q0TKG6|HEMH_ECOL5 Ferrochelatase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=hemH PE=3 SV=1 48 377 3.0E-18
sp|B7MQJ0|HEMH_ECO81 Ferrochelatase OS=Escherichia coli O81 (strain ED1a) GN=hemH PE=3 SV=1 48 377 3.0E-18
sp|A2SIR1|HEMH_METPP Ferrochelatase OS=Methylibium petroleiphilum (strain PM1) GN=hemH PE=3 SV=1 36 378 4.0E-18
sp|B4TMG7|HEMH_SALSV Ferrochelatase OS=Salmonella schwarzengrund (strain CVM19633) GN=hemH PE=3 SV=1 48 370 4.0E-18
sp|Q0BME1|HEMH_FRATO Ferrochelatase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=hemH PE=3 SV=1 49 373 4.0E-18
sp|Q2A406|HEMH_FRATH Ferrochelatase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=hemH PE=3 SV=1 49 373 4.0E-18
sp|Q5FSJ9|HEMH_GLUOX Ferrochelatase OS=Gluconobacter oxydans (strain 621H) GN=hemH PE=3 SV=1 45 382 4.0E-18
sp|A4IYH5|HEMH_FRATW Ferrochelatase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=hemH PE=3 SV=1 49 373 4.0E-18
sp|B2SDE2|HEMH_FRATM Ferrochelatase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=hemH PE=3 SV=1 49 373 4.0E-18
sp|A4QEC1|HEMH_CORGB Ferrochelatase OS=Corynebacterium glutamicum (strain R) GN=hemH PE=3 SV=1 40 373 5.0E-18
sp|Q5QVZ8|HEMH_IDILO Ferrochelatase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=hemH PE=3 SV=1 41 378 5.0E-18
sp|Q8P3H6|HEMH_XANCP Ferrochelatase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=hemH PE=3 SV=2 42 375 5.0E-18
sp|Q3JAW7|HEMH_NITOC Ferrochelatase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=hemH PE=3 SV=1 50 399 5.0E-18
sp|A9MW82|HEMH_SALPB Ferrochelatase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=hemH PE=3 SV=1 48 370 5.0E-18
sp|B5R613|HEMH_SALG2 Ferrochelatase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=hemH PE=3 SV=1 48 370 5.0E-18
sp|B5QU78|HEMH_SALEP Ferrochelatase OS=Salmonella enteritidis PT4 (strain P125109) GN=hemH PE=3 SV=1 48 370 5.0E-18
sp|B5FLJ9|HEMH_SALDC Ferrochelatase OS=Salmonella dublin (strain CT_02021853) GN=hemH PE=3 SV=1 48 370 5.0E-18
sp|Q325C1|HEMH_SHIBS Ferrochelatase OS=Shigella boydii serotype 4 (strain Sb227) GN=hemH PE=3 SV=1 48 377 6.0E-18
sp|B7N928|HEMH_ECOLU Ferrochelatase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=hemH PE=3 SV=1 48 377 6.0E-18
sp|B1IZB9|HEMH_ECOLC Ferrochelatase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=hemH PE=3 SV=1 48 377 6.0E-18
sp|A7ZXD3|HEMH_ECOHS Ferrochelatase OS=Escherichia coli O9:H4 (strain HS) GN=hemH PE=3 SV=1 48 377 6.0E-18
sp|A0Q6Z1|HEMH_FRATN Ferrochelatase OS=Francisella tularensis subsp. novicida (strain U112) GN=hemH PE=3 SV=1 49 373 8.0E-18
sp|Q31EG9|HEMH_THICR Ferrochelatase OS=Thiomicrospira crunogena (strain XCL-2) GN=hemH PE=3 SV=1 38 404 9.0E-18
sp|P37408|HEMH_SALTY Ferrochelatase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=hemH PE=3 SV=2 48 370 9.0E-18
sp|C0PVE1|HEMH_SALPC Ferrochelatase OS=Salmonella paratyphi C (strain RKS4594) GN=hemH PE=3 SV=1 48 370 9.0E-18
sp|B4T9I3|HEMH_SALHS Ferrochelatase OS=Salmonella heidelberg (strain SL476) GN=hemH PE=3 SV=1 48 370 9.0E-18
sp|Q57S74|HEMH_SALCH Ferrochelatase OS=Salmonella choleraesuis (strain SC-B67) GN=hemH PE=3 SV=1 48 370 9.0E-18
sp|B5EXN2|HEMH_SALA4 Ferrochelatase OS=Salmonella agona (strain SL483) GN=hemH PE=3 SV=1 48 370 9.0E-18
sp|Q1B968|HEMH_MYCSS Ferrochelatase OS=Mycobacterium sp. (strain MCS) GN=hemH PE=3 SV=1 49 344 1.0E-17
sp|A1UFU2|HEMH_MYCSK Ferrochelatase OS=Mycobacterium sp. (strain KMS) GN=hemH PE=3 SV=1 49 344 1.0E-17
sp|Q8Z8T2|HEMH_SALTI Ferrochelatase OS=Salmonella typhi GN=hemH PE=3 SV=1 48 370 1.0E-17
sp|Q5NFT3|HEMH_FRATT Ferrochelatase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=hemH PE=3 SV=1 49 373 1.0E-17
sp|Q14H85|HEMH_FRAT1 Ferrochelatase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=hemH PE=3 SV=1 49 373 1.0E-17
sp|A1V0U1|HEMH_BURMS Ferrochelatase OS=Burkholderia mallei (strain SAVP1) GN=hemH PE=3 SV=1 48 378 2.0E-17
sp|Q62HD1|HEMH_BURMA Ferrochelatase OS=Burkholderia mallei (strain ATCC 23344) GN=hemH PE=3 SV=1 48 378 2.0E-17
sp|A2S570|HEMH_BURM9 Ferrochelatase OS=Burkholderia mallei (strain NCTC 10229) GN=hemH PE=3 SV=1 48 378 2.0E-17
sp|A3MNA4|HEMH_BURM7 Ferrochelatase OS=Burkholderia mallei (strain NCTC 10247) GN=hemH PE=3 SV=1 48 378 2.0E-17
sp|Q9JVA5|HEMH_NEIMA Ferrochelatase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=hemH PE=3 SV=1 48 378 2.0E-17
sp|Q32J55|HEMH_SHIDS Ferrochelatase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=hemH PE=3 SV=1 48 377 2.0E-17
sp|B7LV14|HEMH_ESCF3 Ferrochelatase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=hemH PE=3 SV=1 48 377 2.0E-17
sp|B7NIF5|HEMH_ECO7I Ferrochelatase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=hemH PE=3 SV=1 48 377 2.0E-17
sp|B5Z3Y6|HEMH_ECO5E Ferrochelatase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=hemH PE=3 SV=1 48 377 2.0E-17
sp|Q8XD39|HEMH_ECO57 Ferrochelatase OS=Escherichia coli O157:H7 GN=hemH PE=3 SV=1 48 377 2.0E-17
sp|Q63R43|HEMH_BURPS Ferrochelatase OS=Burkholderia pseudomallei (strain K96243) GN=hemH PE=3 SV=1 48 378 2.0E-17
sp|Q3JP06|HEMH_BURP1 Ferrochelatase OS=Burkholderia pseudomallei (strain 1710b) GN=hemH PE=3 SV=1 48 378 2.0E-17
sp|A3NYY2|HEMH_BURP0 Ferrochelatase OS=Burkholderia pseudomallei (strain 1106a) GN=hemH PE=3 SV=1 48 378 2.0E-17
sp|B5BD43|HEMH_SALPK Ferrochelatase OS=Salmonella paratyphi A (strain AKU_12601) GN=hemH PE=3 SV=1 48 370 2.0E-17
sp|Q5PFJ1|HEMH_SALPA Ferrochelatase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=hemH PE=3 SV=1 48 370 2.0E-17
sp|A1KSY0|HEMH_NEIMF Ferrochelatase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=hemH PE=3 SV=1 48 378 2.0E-17
sp|Q5F9U6|HEMH_NEIG1 Ferrochelatase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=hemH PE=3 SV=1 48 378 3.0E-17
sp|Q9K097|HEMH_NEIMB Ferrochelatase OS=Neisseria meningitidis serogroup B (strain MC58) GN=hemH PE=3 SV=2 48 380 3.0E-17
sp|P23871|HEMH_ECOLI Ferrochelatase OS=Escherichia coli (strain K12) GN=hemH PE=1 SV=3 48 377 3.0E-17
sp|B1XFR2|HEMH_ECODH Ferrochelatase OS=Escherichia coli (strain K12 / DH10B) GN=hemH PE=3 SV=1 48 377 3.0E-17
sp|C4ZUS9|HEMH_ECOBW Ferrochelatase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=hemH PE=3 SV=1 48 377 3.0E-17
sp|Q12KR9|HEMH_SHEDO Ferrochelatase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=hemH PE=3 SV=1 45 378 3.0E-17
sp|B2VHX1|HEMH_ERWT9 Ferrochelatase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=hemH PE=3 SV=1 50 343 3.0E-17
sp|Q07H58|HEMH_RHOP5 Ferrochelatase OS=Rhodopseudomonas palustris (strain BisA53) GN=hemH PE=3 SV=1 48 374 3.0E-17
sp|Q6LTE0|HEMH_PHOPR Ferrochelatase OS=Photobacterium profundum GN=hemH PE=3 SV=2 50 377 3.0E-17
sp|A3PZF2|HEMH_MYCSJ Ferrochelatase OS=Mycobacterium sp. (strain JLS) GN=hemH PE=3 SV=1 49 344 3.0E-17
sp|B7M3W7|HEMH_ECO8A Ferrochelatase OS=Escherichia coli O8 (strain IAI1) GN=hemH PE=3 SV=1 48 377 3.0E-17
sp|B2U4S8|HEMH_SHIB3 Ferrochelatase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=hemH PE=3 SV=1 48 377 4.0E-17
sp|Q81GN7|HEMH2_BACCR Ferrochelatase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hemH2 PE=3 SV=1 102 374 4.0E-17
sp|B4SWY3|HEMH_SALNS Ferrochelatase OS=Salmonella newport (strain SL254) GN=hemH PE=3 SV=1 48 370 4.0E-17
sp|Q2NV56|HEMH_SODGM Ferrochelatase OS=Sodalis glossinidius (strain morsitans) GN=hemH PE=3 SV=1 50 378 4.0E-17
sp|B4F1Q1|HEMH_PROMH Ferrochelatase OS=Proteus mirabilis (strain HI4320) GN=hemH PE=3 SV=1 49 343 4.0E-17
sp|B7UKF5|HEMH_ECO27 Ferrochelatase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=hemH PE=3 SV=1 48 377 4.0E-17
sp|Q2IRD5|HEMH_RHOP2 Ferrochelatase OS=Rhodopseudomonas palustris (strain HaA2) GN=hemH PE=3 SV=1 48 343 4.0E-17
sp|A9MLY4|HEMH_SALAR Ferrochelatase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=hemH PE=3 SV=1 48 370 5.0E-17
sp|A4W7F9|HEMH_ENT38 Ferrochelatase OS=Enterobacter sp. (strain 638) GN=hemH PE=3 SV=1 44 376 5.0E-17
sp|Q3SHA3|HEMH_THIDA Ferrochelatase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=hemH PE=3 SV=1 50 378 6.0E-17
sp|Q8U9F7|HEMH_AGRFC Ferrochelatase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=hemH PE=3 SV=2 46 378 6.0E-17
sp|P72183|HEMH_PROFF Ferrochelatase OS=Propionibacterium freudenreichii subsp. freudenreichii GN=hemH PE=3 SV=2 49 373 6.0E-17
sp|Q1QI02|HEMH_NITHX Ferrochelatase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=hemH PE=3 SV=1 43 343 7.0E-17
sp|B7VII4|HEMH_VIBTL Ferrochelatase OS=Vibrio tasmaniensis (strain LGP32) GN=hemH PE=3 SV=1 42 374 7.0E-17
sp|Q1MBW8|HEMH_RHIL3 Ferrochelatase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=hemH PE=3 SV=1 46 343 8.0E-17
sp|B2JGE7|HEMH_BURP8 Ferrochelatase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=hemH PE=3 SV=1 48 378 8.0E-17
sp|B1JW14|HEMH_BURCC Ferrochelatase OS=Burkholderia cenocepacia (strain MC0-3) GN=hemH PE=3 SV=1 40 378 9.0E-17
sp|Q3Z4S4|HEMH_SHISS Ferrochelatase OS=Shigella sonnei (strain Ss046) GN=hemH PE=3 SV=1 50 377 9.0E-17
sp|Q7MMR4|HEMH_VIBVY Ferrochelatase OS=Vibrio vulnificus (strain YJ016) GN=hemH PE=3 SV=2 42 374 9.0E-17
sp|A3ND73|HEMH_BURP6 Ferrochelatase OS=Burkholderia pseudomallei (strain 668) GN=hemH PE=3 SV=1 48 378 1.0E-16
sp|Q8DFM2|HEMH_VIBVU Ferrochelatase OS=Vibrio vulnificus (strain CMCP6) GN=hemH PE=3 SV=2 42 374 1.0E-16
sp|B3QF66|HEMH_RHOPT Ferrochelatase OS=Rhodopseudomonas palustris (strain TIE-1) GN=hemH PE=3 SV=1 48 343 1.0E-16
sp|Q73C08|HEMH2_BACC1 Ferrochelatase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hemH2 PE=3 SV=1 102 374 1.0E-16
sp|A7ZIN5|HEMH_ECO24 Ferrochelatase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=hemH PE=3 SV=1 48 377 2.0E-16
sp|A7NBJ3|HEMH_FRATF Ferrochelatase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=hemH PE=3 SV=1 49 373 2.0E-16
sp|Q92M52|HEMH_RHIME Ferrochelatase OS=Rhizobium meliloti (strain 1021) GN=hemH PE=3 SV=1 38 378 2.0E-16
sp|Q6NBF3|HEMH_RHOPA Ferrochelatase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hemH PE=3 SV=1 48 343 2.0E-16
sp|B6I0C7|HEMH_ECOSE Ferrochelatase OS=Escherichia coli (strain SE11) GN=hemH PE=3 SV=1 48 377 2.0E-16
sp|B7L7A0|HEMH_ECO55 Ferrochelatase OS=Escherichia coli (strain 55989 / EAEC) GN=hemH PE=3 SV=1 48 377 2.0E-16
sp|Q6MHT3|HEMH_BDEBA Ferrochelatase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=hemH PE=3 SV=1 42 376 2.0E-16
sp|B1VXN6|HEMH_STRGG Ferrochelatase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=hemH PE=3 SV=1 49 373 2.0E-16
sp|Q5E6Q7|HEMH_VIBF1 Ferrochelatase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=hemH PE=3 SV=1 48 380 2.0E-16
sp|Q81TU9|HEMH2_BACAN Ferrochelatase 2 OS=Bacillus anthracis GN=hemH2 PE=3 SV=1 102 374 2.0E-16
sp|O50533|HEMH_STRCO Probable ferrochelatase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hemH PE=3 SV=1 49 373 3.0E-16
sp|Q0VSV6|HEMH_ALCBS Ferrochelatase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=hemH PE=3 SV=1 48 378 3.0E-16
sp|Q39JD2|HEMH_BURL3 Ferrochelatase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=hemH PE=3 SV=1 50 378 3.0E-16
sp|Q8PEX0|HEMH_XANAC Ferrochelatase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=hemH PE=3 SV=2 42 351 3.0E-16
sp|Q83SE5|HEMH_SHIFL Ferrochelatase OS=Shigella flexneri GN=hemH PE=3 SV=1 48 377 4.0E-16
sp|Q0T7B0|HEMH_SHIF8 Ferrochelatase OS=Shigella flexneri serotype 5b (strain 8401) GN=hemH PE=3 SV=1 48 377 4.0E-16
sp|Q5YU18|HEMH_NOCFA Ferrochelatase OS=Nocardia farcinica (strain IFM 10152) GN=hemH PE=3 SV=1 49 378 4.0E-16
sp|Q1BYX9|HEMH_BURCA Ferrochelatase OS=Burkholderia cenocepacia (strain AU 1054) GN=hemH PE=3 SV=1 40 378 4.0E-16
sp|Q63EK7|HEMH2_BACCZ Ferrochelatase 2 OS=Bacillus cereus (strain ZK / E33L) GN=hemH2 PE=3 SV=1 102 374 4.0E-16
sp|Q0BI24|HEMH_BURCM Ferrochelatase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=hemH PE=3 SV=1 40 378 5.0E-16
sp|B1YTJ5|HEMH_BURA4 Ferrochelatase OS=Burkholderia ambifaria (strain MC40-6) GN=hemH PE=3 SV=1 40 378 5.0E-16
sp|A4T9I1|HEMH_MYCGI Ferrochelatase OS=Mycobacterium gilvum (strain PYR-GCK) GN=hemH PE=3 SV=1 49 373 6.0E-16
sp|Q13CU0|HEMH_RHOPS Ferrochelatase OS=Rhodopseudomonas palustris (strain BisB5) GN=hemH PE=3 SV=1 48 343 6.0E-16
sp|B2G944|HEMH_LACRJ Ferrochelatase OS=Lactobacillus reuteri (strain JCM 1112) GN=hemH PE=3 SV=1 50 375 7.0E-16
sp|A5VLS3|HEMH_LACRD Ferrochelatase OS=Lactobacillus reuteri (strain DSM 20016) GN=hemH PE=3 SV=1 50 375 7.0E-16
sp|B5FBZ6|HEMH_VIBFM Ferrochelatase OS=Vibrio fischeri (strain MJ11) GN=hemH PE=3 SV=1 48 380 1.0E-15
sp|B0VEC9|HEMH_ACIBY Ferrochelatase OS=Acinetobacter baumannii (strain AYE) GN=hemH PE=3 SV=1 41 381 1.0E-15
sp|B2I2R9|HEMH_ACIBC Ferrochelatase OS=Acinetobacter baumannii (strain ACICU) GN=hemH PE=3 SV=1 41 381 1.0E-15
sp|B7I4A8|HEMH_ACIB5 Ferrochelatase OS=Acinetobacter baumannii (strain AB0057) GN=hemH PE=3 SV=1 41 381 1.0E-15
sp|B7H0X1|HEMH_ACIB3 Ferrochelatase OS=Acinetobacter baumannii (strain AB307-0294) GN=hemH PE=3 SV=1 41 381 1.0E-15
sp|Q03Z41|HEMH_LEUMM Ferrochelatase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=hemH PE=3 SV=1 42 378 1.0E-15
sp|P57874|HEMH_PASMU Ferrochelatase OS=Pasteurella multocida (strain Pm70) GN=hemH PE=3 SV=1 44 332 1.0E-15
sp|Q6HM28|HEMH2_BACHK Ferrochelatase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hemH2 PE=3 SV=1 102 374 1.0E-15
sp|Q2SYZ9|HEMH_BURTA Ferrochelatase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=hemH PE=3 SV=1 48 378 2.0E-15
sp|C4K332|HEMH_HAMD5 Ferrochelatase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=hemH PE=3 SV=1 45 374 3.0E-15
sp|Q5P1H1|HEMH_AROAE Ferrochelatase OS=Aromatoleum aromaticum (strain EbN1) GN=hemH PE=3 SV=1 36 378 3.0E-15
sp|A5EBP8|HEMH_BRASB Ferrochelatase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=hemH PE=3 SV=1 43 391 3.0E-15
sp|Q7NV65|HEMH_CHRVO Ferrochelatase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=hemH PE=3 SV=1 48 378 3.0E-15
sp|A3M1P7|HEMH_ACIBT Ferrochelatase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=hemH PE=3 SV=2 41 381 4.0E-15
sp|Q49YM6|HEMH_STAS1 Ferrochelatase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=hemH PE=3 SV=1 99 372 4.0E-15
sp|B0U456|HEMH_XYLFM Ferrochelatase OS=Xylella fastidiosa (strain M12) GN=hemH PE=3 SV=1 42 379 6.0E-15
sp|B3W963|HEMH_LACCB Ferrochelatase OS=Lactobacillus casei (strain BL23) GN=hemH PE=3 SV=1 50 378 7.0E-15
sp|Q82KJ6|HEMH_STRAW Ferrochelatase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=hemH PE=3 SV=1 49 382 9.0E-15
sp|Q87B82|HEMH_XYLFT Ferrochelatase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=hemH PE=3 SV=1 42 378 1.0E-14
sp|B2I7H7|HEMH_XYLF2 Ferrochelatase OS=Xylella fastidiosa (strain M23) GN=hemH PE=3 SV=1 42 378 1.0E-14
sp|Q036X3|HEMH_LACC3 Ferrochelatase OS=Lactobacillus casei (strain ATCC 334) GN=hemH PE=3 SV=1 50 378 1.0E-14
sp|B6EHK1|HEMH_ALISL Ferrochelatase OS=Aliivibrio salmonicida (strain LFI1238) GN=hemH PE=3 SV=1 50 332 2.0E-14
sp|Q6F7N0|HEMH_ACIAD Ferrochelatase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=hemH PE=3 SV=1 45 378 2.0E-14
sp|Q0RH75|HEMH_FRAAA Ferrochelatase OS=Frankia alni (strain ACN14a) GN=hemH PE=3 SV=1 49 373 3.0E-14
sp|Q83FJ2|HEMH_TROWT Ferrochelatase OS=Tropheryma whipplei (strain Twist) GN=hemH PE=3 SV=1 41 373 3.0E-14
sp|Q83H94|HEMH_TROW8 Ferrochelatase OS=Tropheryma whipplei (strain TW08/27) GN=hemH PE=3 SV=1 41 373 3.0E-14
sp|A4JBR6|HEMH_BURVG Ferrochelatase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=hemH PE=3 SV=1 40 387 3.0E-14
sp|A0QX29|HEMH_MYCS2 Ferrochelatase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=hemH PE=3 SV=1 49 373 3.0E-14
sp|B8GU82|HEMH_THISH Ferrochelatase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=hemH PE=3 SV=1 43 374 3.0E-14
sp|Q7N0P6|HEMH_PHOLL Ferrochelatase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hemH PE=3 SV=1 44 349 4.0E-14
sp|B8EJ84|HEMH_METSB Ferrochelatase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=hemH PE=3 SV=1 37 343 5.0E-14
sp|Q59735|HEMH_RHOCA Ferrochelatase OS=Rhodobacter capsulatus GN=hemH PE=3 SV=1 51 378 6.0E-14
sp|Q8FTB1|HEMH_COREF Ferrochelatase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=hemH PE=3 SV=2 49 373 6.0E-14
sp|Q4ZXU9|HEMH_PSEU2 Ferrochelatase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=hemH PE=3 SV=1 49 370 1.0E-13
sp|Q9PFU1|HEMH_XYLFA Ferrochelatase OS=Xylella fastidiosa (strain 9a5c) GN=hemH PE=3 SV=3 42 379 2.0E-13
sp|Q8CWW4|HEMH_STRMU Ferrochelatase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=hemH PE=3 SV=1 44 378 2.0E-13
sp|B1MC29|HEMH_MYCA9 Ferrochelatase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=hemH PE=3 SV=1 49 343 2.0E-13
sp|Q7UFZ7|HEMH_RHOBA Ferrochelatase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hemH PE=3 SV=1 49 378 2.0E-13
sp|Q7W515|HEMH_BORPA Ferrochelatase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hemH PE=3 SV=1 46 378 2.0E-13
sp|Q83FA4|HEMH_COXBU Ferrochelatase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=hemH PE=3 SV=2 41 378 2.0E-13
sp|Q7WGI0|HEMH_BORBR Ferrochelatase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hemH PE=3 SV=1 46 378 3.0E-13
sp|Q888A2|HEMH_PSESM Ferrochelatase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=hemH PE=3 SV=1 49 370 3.0E-13
sp|P57779|HEMH_ZYMMO Ferrochelatase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=hemH PE=3 SV=2 50 340 3.0E-13
sp|B0VLE0|HEMH_ACIBS Ferrochelatase OS=Acinetobacter baumannii (strain SDF) GN=hemH PE=3 SV=1 41 381 4.0E-13
sp|C5BIF4|HEMH_TERTT Ferrochelatase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=hemH PE=3 SV=1 38 343 4.0E-13
sp|C1F1C7|HEMH_ACIC5 Ferrochelatase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=hemH PE=3 SV=1 49 364 4.0E-13
sp|Q740Y1|HEMH_MYCPA Ferrochelatase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=hemH PE=3 SV=1 49 395 6.0E-13
sp|A9KGX9|HEMH_COXBN Ferrochelatase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=hemH PE=3 SV=2 41 378 6.0E-13
sp|B6J386|HEMH_COXB2 Ferrochelatase OS=Coxiella burnetii (strain CbuG_Q212) GN=hemH PE=3 SV=1 41 378 7.0E-13
sp|Q7VVX8|HEMH_BORPE Ferrochelatase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hemH PE=3 SV=2 46 378 8.0E-13
sp|B6J5R6|HEMH_COXB1 Ferrochelatase OS=Coxiella burnetii (strain CbuK_Q154) GN=hemH PE=3 SV=1 41 378 1.0E-12
sp|Q48MT5|HEMH_PSE14 Ferrochelatase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=hemH PE=3 SV=1 49 370 1.0E-12
sp|A1U0R2|HEMH_MARHV Ferrochelatase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=hemH PE=3 SV=1 142 378 3.0E-12
sp|Q9CBM2|HEMH_MYCLE Ferrochelatase OS=Mycobacterium leprae (strain TN) GN=hemH PE=3 SV=1 49 344 4.0E-12
sp|B8ZS79|HEMH_MYCLB Ferrochelatase OS=Mycobacterium leprae (strain Br4923) GN=hemH PE=3 SV=1 49 344 4.0E-12
sp|Q15NQ1|HEMH_PSEA6 Ferrochelatase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=hemH PE=3 SV=1 142 384 4.0E-12
sp|B0KNF5|HEMH_PSEPG Ferrochelatase OS=Pseudomonas putida (strain GB-1) GN=hemH PE=3 SV=1 49 374 5.0E-12
sp|O07401|HEMH_MYCAV Ferrochelatase OS=Mycobacterium avium GN=hemH PE=3 SV=1 250 395 1.0E-11
sp|Q978U9|HEMH_THEVO Ferrochelatase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hemH PE=3 SV=1 48 384 1.0E-11
sp|B2HPD6|HEMH_MYCMM Ferrochelatase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=hemH PE=3 SV=1 49 366 1.0E-11
sp|Q1IEW1|HEMH_PSEE4 Ferrochelatase OS=Pseudomonas entomophila (strain L48) GN=hemH PE=3 SV=1 49 371 2.0E-11
sp|C1C6Y5|HEMH_STRP7 Ferrochelatase OS=Streptococcus pneumoniae (strain 70585) GN=hemH PE=3 SV=1 98 343 3.0E-11
sp|Q88XC3|HEMH_LACPL Ferrochelatase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=hemH PE=3 SV=1 50 374 7.0E-11
sp|A0QHT7|HEMH_MYCA1 Ferrochelatase OS=Mycobacterium avium (strain 104) GN=hemH PE=3 SV=1 49 395 8.0E-11
sp|A5VYH6|HEMH_PSEP1 Ferrochelatase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=hemH PE=3 SV=1 49 374 9.0E-11
sp|A0PNU6|HEMH_MYCUA Ferrochelatase OS=Mycobacterium ulcerans (strain Agy99) GN=hemH PE=3 SV=1 49 344 2.0E-10
sp|Q02Y14|HEMH_LACLS Ferrochelatase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=hemH PE=3 SV=1 42 377 2.0E-10
sp|A1K8P4|HEMH_AZOSB Ferrochelatase OS=Azoarcus sp. (strain BH72) GN=hemH PE=3 SV=1 43 370 4.0E-10
sp|Q88PV4|HEMH_PSEPK Ferrochelatase OS=Pseudomonas putida (strain KT2440) GN=hemH PE=3 SV=1 49 373 4.0E-10
sp|Q4K6B3|HEMH_PSEF5 Ferrochelatase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hemH PE=3 SV=1 49 370 5.0E-10
sp|A2RJS3|HEMH_LACLM Ferrochelatase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=hemH PE=3 SV=1 42 377 9.0E-10
sp|C1DEU1|HEMH_AZOVD Ferrochelatase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=hemH PE=3 SV=1 49 376 1.0E-09
sp|P9WNE3|HEMH_MYCTU Ferrochelatase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hemH PE=1 SV=1 49 397 1.0E-09
sp|P9WNE2|HEMH_MYCTO Ferrochelatase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hemH PE=3 SV=1 49 397 1.0E-09
sp|A5U2I9|HEMH_MYCTA Ferrochelatase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=hemH PE=3 SV=1 49 397 1.0E-09
sp|C1AND1|HEMH_MYCBT Ferrochelatase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=hemH PE=3 SV=1 49 397 1.0E-09
sp|A1KIS5|HEMH_MYCBP Ferrochelatase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=hemH PE=3 SV=1 49 397 1.0E-09
sp|P0A577|HEMH_MYCBO Ferrochelatase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=hemH PE=3 SV=1 49 397 1.0E-09
sp|B1IBG8|HEMH_STRPI Ferrochelatase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=hemH PE=3 SV=1 98 343 2.0E-09
sp|Q3K6Y7|HEMH_PSEPF Ferrochelatase OS=Pseudomonas fluorescens (strain Pf0-1) GN=hemH PE=3 SV=1 49 374 3.0E-09
sp|Q9CFB4|HEMH_LACLA Ferrochelatase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=hemH PE=3 SV=1 42 374 4.0E-09
sp|A4XR78|HEMH_PSEMY Ferrochelatase OS=Pseudomonas mendocina (strain ymp) GN=hemH PE=3 SV=1 49 370 5.0E-09
sp|Q9HLB8|HEMH_THEAC Ferrochelatase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hemH PE=3 SV=1 48 385 1.0E-08
sp|C3KDN7|HEMH_PSEFS Ferrochelatase OS=Pseudomonas fluorescens (strain SBW25) GN=hemH PE=3 SV=1 49 370 1.0E-08
sp|Q1H397|HEMH_METFK Ferrochelatase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=hemH PE=3 SV=1 48 378 1.0E-08
sp|Q6AHF2|HEMH_LEIXX Ferrochelatase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=hemH PE=3 SV=1 206 348 7.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006783 heme biosynthetic process Yes
GO:0004325 ferrochelatase activity Yes
GO:0042440 pigment metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0006779 porphyrin-containing compound biosynthetic process No
GO:0009987 cellular process No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:0042168 heme metabolic process No
GO:0033013 tetrapyrrole metabolic process No
GO:0033014 tetrapyrrole biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0016829 lyase activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0046148 pigment biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006778 porphyrin-containing compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2599
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5309
Ophiocordyceps australis map64 (Brazil) OphauB2|4238
Ophiocordyceps camponoti-floridani Ophcf2|04205
Ophiocordyceps camponoti-rufipedis Ophun1|6112 (this protein)
Ophiocordyceps kimflemingae Ophio5|8007
Ophiocordyceps subramaniannii Hirsu2|3931

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6112
MMMRQASQTLTRAVPRTASLSLGSQSRRHLATTAPPVTQNSMGSKGPTAMVFLNMGGPSTTSEVGDFLSRLFADG
DLIPLGRLQAYIGPLISARRTPKIQKQYDAIGGGSPIRKWSEHQNAEMCKLLDKISPETAPHKPYVAFRYADPLT
EEMYEKLLQDGFGNGRGGRAVAFTQYPQYSCSTTGSSLNELWKWRQRLEGKTAMDGARGTIAWSVIDRWPAHRGL
IEAFAQNIEAKLAEYPEERRKDVVLLFSAHSLPMSVVNRGDPYPAEVAATVYGVMQRLRFSNSYRLCWQSQVGPS
AWLGPQTSSTVEEYIAKGKKDLVLIPIAFTSDHIETLYELDEEVIGESGHTDTVKRAESLNGSPVFIEALADIAR
THLMSGQACSRQMGLRCPGCKSERCFESKKFFAGQQTELSAVTQ*
Coding >Ophun1|6112
ATGATGATGCGGCAAGCAAGCCAGACGTTAACCAGAGCTGTGCCGAGGACCGCTTCCCTGAGCCTCGGAAGCCAG
TCAAGAAGACACCTGGCCACGACGGCGCCTCCCGTGACGCAGAATTCCATGGGTTCCAAGGGGCCTACAGCCATG
GTCTTTCTCAATATGGGAGGCCCCTCGACGACCAGTGAAGTCGGCGACTTCCTCAGCCGCTTATTCGCCGACGGC
GACCTGATCCCCCTGGGCAGGCTTCAGGCTTACATCGGGCCCCTGATCTCGGCCAGGCGGACGCCAAAGATACAG
AAACAGTACGACGCAATTGGCGGCGGGTCTCCCATCCGCAAATGGTCGGAACACCAGAACGCCGAGATGTGCAAA
CTACTTGACAAGATTTCGCCCGAGACGGCACCTCACAAGCCCTACGTCGCCTTTCGCTATGCCGATCCGCTGACG
GAAGAGATGTACGAGAAGCTGCTGCAGGACGGCTTCGGCAACGGCAGAGGGGGCCGGGCCGTCGCCTTTACGCAG
TATCCTCAGTATTCGTGCTCTACCACGGGCAGTAGCTTGAACGAGCTGTGGAAGTGGCGGCAACGGTTGGAGGGT
AAGACGGCCATGGACGGCGCGCGCGGCACGATAGCCTGGAGCGTCATCGATCGGTGGCCAGCCCACCGTGGGTTG
ATCGAGGCTTTTGCCCAGAACATCGAGGCGAAACTAGCAGAGTATCCGGAAGAGAGACGGAAGGATGTTGTGCTG
CTGTTCTCCGCGCACAGCTTGCCCATGTCCGTCGTCAACAGAGGGGATCCCTACCCGGCCGAGGTCGCCGCCACC
GTATACGGCGTGATGCAACGACTGCGGTTCTCGAATTCCTATCGCCTGTGCTGGCAGTCCCAGGTCGGACCTTCG
GCGTGGCTCGGTCCTCAGACGTCCAGTACGGTCGAGGAGTACATCGCCAAGGGGAAAAAAGACCTCGTGCTGATT
CCCATCGCCTTTACGTCCGACCACATCGAGACTCTGTACGAGCTGGACGAGGAGGTCATCGGCGAGAGTGGCCAC
ACGGACACGGTAAAGAGGGCAGAGAGCCTCAACGGCAGCCCCGTCTTCATCGAGGCCCTGGCAGACATCGCCAGG
ACGCATCTCATGAGCGGTCAGGCCTGCTCGAGACAGATGGGGCTGCGTTGCCCCGGTTGCAAGAGCGAGCGATGT
TTCGAGTCCAAGAAGTTCTTTGCTGGCCAACAGACCGAGTTGAGCGCGGTGACACAATGA
Transcript >Ophun1|6112
ATGATGATGCGGCAAGCAAGCCAGACGTTAACCAGAGCTGTGCCGAGGACCGCTTCCCTGAGCCTCGGAAGCCAG
TCAAGAAGACACCTGGCCACGACGGCGCCTCCCGTGACGCAGAATTCCATGGGTTCCAAGGGGCCTACAGCCATG
GTCTTTCTCAATATGGGAGGCCCCTCGACGACCAGTGAAGTCGGCGACTTCCTCAGCCGCTTATTCGCCGACGGC
GACCTGATCCCCCTGGGCAGGCTTCAGGCTTACATCGGGCCCCTGATCTCGGCCAGGCGGACGCCAAAGATACAG
AAACAGTACGACGCAATTGGCGGCGGGTCTCCCATCCGCAAATGGTCGGAACACCAGAACGCCGAGATGTGCAAA
CTACTTGACAAGATTTCGCCCGAGACGGCACCTCACAAGCCCTACGTCGCCTTTCGCTATGCCGATCCGCTGACG
GAAGAGATGTACGAGAAGCTGCTGCAGGACGGCTTCGGCAACGGCAGAGGGGGCCGGGCCGTCGCCTTTACGCAG
TATCCTCAGTATTCGTGCTCTACCACGGGCAGTAGCTTGAACGAGCTGTGGAAGTGGCGGCAACGGTTGGAGGGT
AAGACGGCCATGGACGGCGCGCGCGGCACGATAGCCTGGAGCGTCATCGATCGGTGGCCAGCCCACCGTGGGTTG
ATCGAGGCTTTTGCCCAGAACATCGAGGCGAAACTAGCAGAGTATCCGGAAGAGAGACGGAAGGATGTTGTGCTG
CTGTTCTCCGCGCACAGCTTGCCCATGTCCGTCGTCAACAGAGGGGATCCCTACCCGGCCGAGGTCGCCGCCACC
GTATACGGCGTGATGCAACGACTGCGGTTCTCGAATTCCTATCGCCTGTGCTGGCAGTCCCAGGTCGGACCTTCG
GCGTGGCTCGGTCCTCAGACGTCCAGTACGGTCGAGGAGTACATCGCCAAGGGGAAAAAAGACCTCGTGCTGATT
CCCATCGCCTTTACGTCCGACCACATCGAGACTCTGTACGAGCTGGACGAGGAGGTCATCGGCGAGAGTGGCCAC
ACGGACACGGTAAAGAGGGCAGAGAGCCTCAACGGCAGCCCCGTCTTCATCGAGGCCCTGGCAGACATCGCCAGG
ACGCATCTCATGAGCGGTCAGGCCTGCTCGAGACAGATGGGGCTGCGTTGCCCCGGTTGCAAGAGCGAGCGATGT
TTCGAGTCCAAGAAGTTCTTTGCTGGCCAACAGACCGAGTTGAGCGCGGTGACACAATGA
Gene >Ophun1|6112
ATGATGATGCGGCAAGCAAGCCAGACGTTAACCAGAGCTGTGCCGAGGACCGCTTCCCTGAGCCTCGGAAGCCAG
TCAAGAAGACACCTGGCCACGACGGCGCCTCCCGTGACGCAGAATTCCATGGGTTCCAAGGGGCCTACAGCCATG
GTCTTTCTCAATATGGGAGGCCCCTCGACGACCAGTGAAGTCGGCGACTTCCTCAGCCGCTTATTCGTATGCGCG
TCTCTTCGCCAGAGACCGACTCCCCTAGCTGATGGGAATCCAGGCCGACGGCGACCTGATCCCCCTGGGCAGGCT
TCAGGCTTACATCGGGCCCCTGATCTCGGCCAGGCGGACGCCAAAGATACAGAAACAGTACGACGCAATTGGCGG
CGGGTCTCCCATCCGCAAATGGTCGGAACACCAGAACGCCGAGATGTGCAAACTACTTGACAAGATTTCGCCCGA
GACGGCACCTCACAAGCCCTACGTCGCCTTTCGCTATGCCGATCCGCTGACGGAAGAGATGTACGAGAAGCTGCT
GCAGGACGGCTTCGGCAACGGCAGAGGGGGCCGGGCCGTCGCCTTTACGCAGTATCCTCAGTATTCGTGCTCTAC
CACGGGCAGTAGCTTGAACGAGCTGTGGAAGTGGCGGCAACGGTTGGAGGGTAAGACGGCCATGGACGGCGCGCG
CGGCACGATAGCCTGGAGCGTCATCGATCGGTGGCCAGCCCACCGTGGGTTGATCGAGGCTTTTGCCCAGAACAT
CGAGGCGAAACTAGCAGAGTATCCGGAAGAGAGACGGAAGGATGTTGTGCTGCTGTTCTCCGCGCACAGCTTGCC
CATGTCCGTCGTCAACAGAGGTAATGACTAACCGCCAGTCAAGATAGTCTCAGCTTCGGCTAATGAGCATGATAG
GGGATCCCTACCCGGCCGAGGTCGCCGCCACCGTATACGGCGTGATGCAACGACTGCGGTTCTCGAATTCCTATC
GCCTGTGCTGGCAGTCCCAGGTCGGACCTTCGGCGTGGCTCGGTCCTCAGACGTCCAGTACGGTCGAGGAGTACA
TCGCCAAGGGGAAAAAAGACCTCGTGCTGATTCCCATCGCCTTTACGTCCGACCACATCGAGACTCTGTACGAGC
TGGACGAGGAGGTCATCGGCGAGAGTGGCCACACGGACACGGTAAAGAGGGCAGAGAGCCTCAACGGCAGCCCCG
TCTTCATCGAGGCCCTGGCAGACATCGCCAGGACGCATCTCATGAGCGGTCAGGCCTGCTCGAGACAGATGGGGC
TGCGTTGCCCCGGTTGCAAGAGCGAGCGATGTTTCGAGTCCAAGAAGTTCTTTGCTGGCCAACAGACCGAGTTGA
GCGCGGTGACACAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail