Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6105
Gene name
LocationContig_643:64..3215
Strand-
Gene length (bp)3151
Transcript length (bp)2979
Coding sequence length (bp)2979
Protein length (aa) 993

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08638 Med14 Mediator complex subunit MED14 1.2E-66 108 317

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S154|MED14_NEUCR Mediator of RNA polymerase II transcription subunit 14 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rgr1 PE=3 SV=2 49 990 0.0E+00
sp|A4R0J9|MED14_MAGO7 Mediator of RNA polymerase II transcription subunit 14 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RGR1 PE=3 SV=1 63 990 0.0E+00
sp|Q2HDU8|MED14_CHAGB Mediator of RNA polymerase II transcription subunit 14 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RGR1 PE=3 SV=1 94 989 7.0E-171
sp|A2QFK0|MED14_ASPNC Mediator of RNA polymerase II transcription subunit 14 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rgr1 PE=3 SV=2 27 981 2.0E-109
sp|Q5AW92|MED14_EMENI Mediator of RNA polymerase II transcription subunit 14 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rgr1 PE=3 SV=2 98 951 2.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S154|MED14_NEUCR Mediator of RNA polymerase II transcription subunit 14 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rgr1 PE=3 SV=2 49 990 0.0E+00
sp|A4R0J9|MED14_MAGO7 Mediator of RNA polymerase II transcription subunit 14 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RGR1 PE=3 SV=1 63 990 0.0E+00
sp|Q2HDU8|MED14_CHAGB Mediator of RNA polymerase II transcription subunit 14 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RGR1 PE=3 SV=1 94 989 7.0E-171
sp|A2QFK0|MED14_ASPNC Mediator of RNA polymerase II transcription subunit 14 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rgr1 PE=3 SV=2 27 981 2.0E-109
sp|Q5AW92|MED14_EMENI Mediator of RNA polymerase II transcription subunit 14 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rgr1 PE=3 SV=2 98 951 2.0E-103
sp|Q0CL23|MED14_ASPTN Mediator of RNA polymerase II transcription subunit 14 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rgr1 PE=3 SV=2 39 954 2.0E-96
sp|Q2UMJ1|MED14_ASPOR Mediator of RNA polymerase II transcription subunit 14 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rgr1 PE=3 SV=2 87 909 2.0E-94
sp|A1C5W6|MED14_ASPCL Mediator of RNA polymerase II transcription subunit 14 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rgr1 PE=3 SV=1 100 981 2.0E-89
sp|Q4WH96|MED14_ASPFU Mediator of RNA polymerase II transcription subunit 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rgr1 PE=3 SV=1 50 981 9.0E-86
sp|A1DG38|MED14_NEOFI Mediator of RNA polymerase II transcription subunit 14 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rgr1 PE=3 SV=1 50 981 1.0E-84
sp|Q1DZL3|MED14_COCIM Mediator of RNA polymerase II transcription subunit 14 OS=Coccidioides immitis (strain RS) GN=RGR1 PE=3 SV=2 94 948 3.0E-83
sp|Q6C9Z2|MED14_YARLI Mediator of RNA polymerase II transcription subunit 14 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RGR1 PE=3 SV=1 145 644 2.0E-51
sp|A3LZ54|MED14_PICST Mediator of RNA polymerase II transcription subunit 14 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RGR1 PE=3 SV=3 98 724 1.0E-34
sp|Q9P7Y4|MED14_SCHPO Mediator of RNA polymerase II transcription subunit 14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=med14 PE=1 SV=2 98 494 2.0E-29
sp|Q5AG31|MED14_CANAL Mediator of RNA polymerase II transcription subunit 14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RGR1 PE=3 SV=2 98 455 2.0E-29
sp|Q6BPK1|MED14_DEBHA Mediator of RNA polymerase II transcription subunit 14 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RGR1 PE=3 SV=2 88 715 9.0E-26
sp|Q75CZ2|MED14_ASHGO Mediator of RNA polymerase II transcription subunit 14 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RGR1 PE=3 SV=2 96 635 2.0E-23
sp|O60244|MED14_HUMAN Mediator of RNA polymerase II transcription subunit 14 OS=Homo sapiens GN=MED14 PE=1 SV=2 158 494 7.0E-20
sp|A2ABV5|MED14_MOUSE Mediator of RNA polymerase II transcription subunit 14 OS=Mus musculus GN=Med14 PE=1 SV=1 158 479 2.0E-19
sp|Q6CRY2|MED14_KLULA Mediator of RNA polymerase II transcription subunit 14 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RGR1 PE=3 SV=1 159 637 1.0E-18
sp|Q6FKA5|MED14_CANGA Mediator of RNA polymerase II transcription subunit 14 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RGR1 PE=3 SV=1 98 643 9.0E-18
sp|Q03570|MED14_CAEEL Mediator of RNA polymerase II transcription subunit 14 OS=Caenorhabditis elegans GN=rgr-1 PE=3 SV=6 161 414 2.0E-16
sp|Q61IR6|MED14_CAEBR Mediator of RNA polymerase II transcription subunit 14 OS=Caenorhabditis briggsae GN=rgr-1 PE=3 SV=3 161 414 3.0E-15
sp|Q7Q6S8|MED14_ANOGA Mediator of RNA polymerase II transcription subunit 14 OS=Anopheles gambiae GN=MED14 PE=3 SV=5 158 410 8.0E-15
sp|Q16U49|MED14_AEDAE Mediator of RNA polymerase II transcription subunit 14 OS=Aedes aegypti GN=MED14 PE=3 SV=2 158 410 2.0E-13
sp|P19263|MED14_YEAST Mediator of RNA polymerase II transcription subunit 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGR1 PE=1 SV=2 158 635 3.0E-11
sp|P0CB66|MED14_DICDI Putative mediator of RNA polymerase II transcription subunit 14 OS=Dictyostelium discoideum GN=med14 PE=3 SV=1 109 410 3.0E-10
sp|Q4P0P3|MED14_USTMA Mediator of RNA polymerase II transcription subunit 14 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RGR1 PE=3 SV=2 108 347 2.0E-09
sp|Q9W0P8|MED14_DROME Mediator of RNA polymerase II transcription subunit 14 OS=Drosophila melanogaster GN=MED14 PE=1 SV=4 158 388 2.0E-09
sp|Q29FF7|MED14_DROPS Mediator of RNA polymerase II transcription subunit 14 OS=Drosophila pseudoobscura pseudoobscura GN=MED14 PE=3 SV=2 158 388 4.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016592 mediator complex Yes
GO:0003712 transcription coregulator activity Yes
GO:0006357 regulation of transcription by RNA polymerase II Yes
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0140110 transcription regulator activity No
GO:0009889 regulation of biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0032991 protein-containing complex No
GO:0010468 regulation of gene expression No
GO:0140513 nuclear protein-containing complex No
GO:2001141 regulation of RNA biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0006355 regulation of transcription, DNA-templated No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0065007 biological regulation No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0050789 regulation of biological process No
GO:0031326 regulation of cellular biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5738
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1283
Ophiocordyceps australis map64 (Brazil) OphauB2|3052
Ophiocordyceps camponoti-floridani Ophcf2|04395
Ophiocordyceps camponoti-rufipedis Ophun1|6105 (this protein)
Ophiocordyceps kimflemingae Ophio5|5952
Ophiocordyceps subramaniannii Hirsu2|9125

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6105
MPITAQSVSFRLFTLALVLLQRLPIERHGRSWPAAGLERDTMALASSNNGDVNNGNTNNSSNNNNNGDVNASANA
NANLNLNLNLNLNGARSRMNDLPDEIIHITQGFVPLSLLLTRLAQTSHNALQDKMAELAKMPLPATAVNGNATSA
LDDTSTDNLRKKAALASFAQDLHGKWLKALVITEWSRKSDMVSKLIDLKFHIDQQRILYDACLDNVVNVKRDLTF
ARMPSPDLKTALQILSTGTAPWMPDLNYIEPPRLTPREQLKWISDLNTLLSLRLNLDDYDKIPPHFKDYDIASGR
VTFKVDGEFHVDLTIADEDLEKQYWFIDFRYDFSPAPASLSPALRAYLEGCVNEALSKEGLAGCYRCLHEFVLTS
KINELKRQAVKLSRTSWTGTLSVEPLNRALAIQYWTSRAVTTGTKSWILLAVNSGRKPDVTVQDERATSFIVAKW
YRNGKEVKDVDVELDLKRLSAESLLTDAIGRHIDSILTSVHDKLLTAARYKDGEASLVLDLCRSDPAASSLSMQV
GRTTLSVEPTTGVFVLKPQSKFTAPYEHQLNNGRNVADDGAACLENVRCAVMEDEMQRRGSMMGWRVRKPPLTVE
ETKTATRLRTWTRALWLQRDGWGAGWFMAVFLGASSDEWWLVEVSAAEAGINRRSPMAEGFTKGGGRSVKFKSKL
PLPKGQLDLTDDFWSKLTLFTTGMMTQSMDVRELQRHKIKSRLSDGTDLSASRPVRLPSLEIPLSAVFPSMATTT
REGDLSAQDVELFSLMQKYTGAALTMRRAWADDVVQLNFVGMRSRPDGELVCLSEAVVRVRKRSRLAALKDMVDG
GVVYRPRRGEFSVQLERRLGEPMVEALRTRIKAVDRFVNMVEALDRAGGSLSTEEMTLGRVTFCYGEDRAWRLEL
ELSSDEMRISVSPGNPHLRVMDLMRRLVNSDGGIGALIAWLPASLPALQAVSAMESHWEAAGSRGRLTLTMKSPA
WMMLTYDVVDGRGRRRR*
Coding >Ophun1|6105
ATGCCGATTACAGCCCAAAGCGTCTCTTTTCGACTCTTCACGCTCGCTCTCGTCCTCCTCCAGCGACTCCCCATC
GAGCGGCATGGGCGCAGCTGGCCCGCAGCCGGCCTCGAGAGGGACACGATGGCGCTGGCCTCCTCCAACAACGGT
GACGTCAACAACGGCAACACCAATAACAGCAGCAACAACAACAACAACGGCGACGTCAACGCCAGCGCCAACGCC
AACGCCAACCTCAACCTCAACCTCAACCTCAACCTCAACGGCGCGCGATCGCGAATGAACGACCTGCCAGACGAA
ATCATCCACATCACCCAGGGCTTCGTCCCCCTGTCTCTGCTGCTGACGCGCCTGGCTCAGACGTCGCATAATGCC
CTCCAAGACAAGATGGCCGAGCTGGCCAAGATGCCGCTGCCCGCCACCGCCGTCAACGGCAACGCGACGTCGGCC
CTCGACGATACCTCGACCGATAACCTCCGCAAAAAGGCCGCCCTCGCCAGCTTCGCCCAGGACCTCCATGGGAAG
TGGCTCAAGGCTCTCGTTATAACAGAGTGGAGCAGGAAGTCGGACATGGTCAGCAAGCTCATCGACCTCAAGTTC
CACATCGATCAGCAGCGCATCCTCTACGACGCCTGTCTCGACAACGTCGTCAACGTCAAGCGGGACTTGACTTTT
GCGCGCATGCCCAGTCCCGACCTCAAGACGGCCCTGCAGATTCTCTCCACCGGCACCGCGCCTTGGATGCCCGAT
CTCAACTACATCGAACCCCCCCGTCTCACCCCTCGCGAGCAGCTCAAGTGGATCAGCGATCTCAACACCTTGCTG
TCGCTGAGGTTAAATCTCGACGACTACGACAAGATTCCTCCCCACTTCAAAGACTACGACATTGCGTCCGGCCGC
GTCACCTTCAAGGTTGACGGCGAGTTCCACGTCGACCTTACCATTGCCGACGAGGACCTTGAAAAGCAGTATTGG
TTCATCGATTTCCGATACGACTTTAGCCCGGCGCCCGCCTCGCTGTCTCCCGCCCTCAGGGCCTACTTGGAGGGA
TGCGTCAACGAGGCGCTCAGCAAGGAAGGCCTGGCCGGATGCTACCGTTGTCTTCACGAGTTCGTCCTGACGTCC
AAGATCAACGAGCTGAAGCGCCAGGCCGTCAAGCTGAGCAGGACCTCGTGGACGGGAACCCTCTCGGTGGAGCCG
CTCAACCGCGCCCTGGCCATACAGTACTGGACGTCGCGGGCCGTCACGACGGGGACCAAGAGCTGGATCCTGCTG
GCCGTCAACAGCGGACGCAAACCCGACGTCACCGTCCAAGACGAGAGGGCCACGAGCTTCATCGTGGCCAAGTGG
TACCGCAACGGCAAAGAGGTCAAGGACGTCGACGTCGAGCTCGACCTCAAGAGACTGTCGGCCGAATCCCTCCTG
ACGGACGCAATCGGCCGGCACATCGACTCCATCCTGACGAGCGTCCACGACAAGCTGTTGACGGCGGCGCGCTAC
AAGGACGGCGAGGCCAGCTTGGTACTGGACCTGTGCCGGTCGGATCCGGCGGCGTCTTCGCTGTCGATGCAGGTC
GGCAGGACGACGTTATCCGTGGAGCCGACGACGGGCGTCTTCGTCCTCAAGCCTCAGTCCAAGTTCACGGCGCCG
TACGAGCATCAGTTGAACAATGGCAGAAACGTGGCCGACGACGGCGCGGCCTGTCTGGAGAATGTGCGATGCGCC
GTCATGGAAGACGAGATGCAGCGGCGCGGGAGCATGATGGGATGGAGGGTTCGCAAGCCGCCGCTGACGGTGGAG
GAGACCAAGACGGCGACGAGGCTGCGGACATGGACGAGGGCTCTCTGGCTGCAGAGGGACGGCTGGGGCGCGGGC
TGGTTCATGGCCGTGTTCCTGGGAGCATCGAGCGACGAGTGGTGGCTCGTCGAGGTTTCTGCGGCCGAGGCGGGC
ATCAACCGACGCTCTCCCATGGCAGAGGGCTTCACCAAGGGCGGCGGACGGTCTGTCAAGTTTAAGAGCAAGCTG
CCGCTCCCCAAGGGCCAGCTGGACCTGACGGACGACTTCTGGAGCAAGCTGACGTTGTTCACGACGGGCATGATG
ACGCAGTCGATGGACGTGCGGGAGCTACAGCGACACAAGATTAAGAGCCGGCTGAGCGACGGCACGGATCTATCG
GCTTCACGGCCGGTGCGGCTGCCATCGCTGGAGATTCCGCTATCGGCCGTGTTCCCTTCCATGGCAACGACGACG
CGAGAAGGCGACTTGAGCGCCCAAGACGTCGAGCTGTTCTCGCTGATGCAAAAGTACACGGGCGCGGCTCTGACG
ATGCGACGGGCCTGGGCCGACGACGTGGTGCAGCTCAACTTTGTAGGGATGCGGTCGCGGCCCGATGGCGAGCTC
GTCTGTCTCTCCGAGGCCGTGGTCCGAGTGCGCAAGCGGTCGAGGCTGGCGGCGCTCAAGGACATGGTGGACGGG
GGCGTCGTCTACAGGCCTCGTCGGGGCGAGTTCTCGGTCCAGCTGGAGCGGCGGCTGGGCGAGCCCATGGTGGAG
GCCCTCCGGACGCGCATCAAGGCCGTGGACCGGTTCGTCAACATGGTCGAGGCGCTGGACCGGGCGGGAGGCTCG
CTGTCGACGGAAGAGATGACGCTGGGACGGGTGACGTTTTGCTACGGCGAGGACCGGGCCTGGCGGCTGGAGCTG
GAGCTGTCGTCGGACGAGATGCGCATCTCGGTATCGCCTGGCAACCCTCACCTCCGGGTCATGGACCTGATGAGG
AGGCTGGTCAACAGCGACGGCGGCATCGGCGCCCTGATAGCCTGGCTGCCCGCCTCGCTGCCAGCCCTCCAGGCG
GTATCGGCCATGGAATCCCACTGGGAAGCAGCCGGTTCTCGGGGTCGGCTGACGCTGACGATGAAGTCGCCGGCC
TGGATGATGCTGACGTACGACGTCGTCGACGGGCGCGGACGGCGCCGACGATGA
Transcript >Ophun1|6105
ATGCCGATTACAGCCCAAAGCGTCTCTTTTCGACTCTTCACGCTCGCTCTCGTCCTCCTCCAGCGACTCCCCATC
GAGCGGCATGGGCGCAGCTGGCCCGCAGCCGGCCTCGAGAGGGACACGATGGCGCTGGCCTCCTCCAACAACGGT
GACGTCAACAACGGCAACACCAATAACAGCAGCAACAACAACAACAACGGCGACGTCAACGCCAGCGCCAACGCC
AACGCCAACCTCAACCTCAACCTCAACCTCAACCTCAACGGCGCGCGATCGCGAATGAACGACCTGCCAGACGAA
ATCATCCACATCACCCAGGGCTTCGTCCCCCTGTCTCTGCTGCTGACGCGCCTGGCTCAGACGTCGCATAATGCC
CTCCAAGACAAGATGGCCGAGCTGGCCAAGATGCCGCTGCCCGCCACCGCCGTCAACGGCAACGCGACGTCGGCC
CTCGACGATACCTCGACCGATAACCTCCGCAAAAAGGCCGCCCTCGCCAGCTTCGCCCAGGACCTCCATGGGAAG
TGGCTCAAGGCTCTCGTTATAACAGAGTGGAGCAGGAAGTCGGACATGGTCAGCAAGCTCATCGACCTCAAGTTC
CACATCGATCAGCAGCGCATCCTCTACGACGCCTGTCTCGACAACGTCGTCAACGTCAAGCGGGACTTGACTTTT
GCGCGCATGCCCAGTCCCGACCTCAAGACGGCCCTGCAGATTCTCTCCACCGGCACCGCGCCTTGGATGCCCGAT
CTCAACTACATCGAACCCCCCCGTCTCACCCCTCGCGAGCAGCTCAAGTGGATCAGCGATCTCAACACCTTGCTG
TCGCTGAGGTTAAATCTCGACGACTACGACAAGATTCCTCCCCACTTCAAAGACTACGACATTGCGTCCGGCCGC
GTCACCTTCAAGGTTGACGGCGAGTTCCACGTCGACCTTACCATTGCCGACGAGGACCTTGAAAAGCAGTATTGG
TTCATCGATTTCCGATACGACTTTAGCCCGGCGCCCGCCTCGCTGTCTCCCGCCCTCAGGGCCTACTTGGAGGGA
TGCGTCAACGAGGCGCTCAGCAAGGAAGGCCTGGCCGGATGCTACCGTTGTCTTCACGAGTTCGTCCTGACGTCC
AAGATCAACGAGCTGAAGCGCCAGGCCGTCAAGCTGAGCAGGACCTCGTGGACGGGAACCCTCTCGGTGGAGCCG
CTCAACCGCGCCCTGGCCATACAGTACTGGACGTCGCGGGCCGTCACGACGGGGACCAAGAGCTGGATCCTGCTG
GCCGTCAACAGCGGACGCAAACCCGACGTCACCGTCCAAGACGAGAGGGCCACGAGCTTCATCGTGGCCAAGTGG
TACCGCAACGGCAAAGAGGTCAAGGACGTCGACGTCGAGCTCGACCTCAAGAGACTGTCGGCCGAATCCCTCCTG
ACGGACGCAATCGGCCGGCACATCGACTCCATCCTGACGAGCGTCCACGACAAGCTGTTGACGGCGGCGCGCTAC
AAGGACGGCGAGGCCAGCTTGGTACTGGACCTGTGCCGGTCGGATCCGGCGGCGTCTTCGCTGTCGATGCAGGTC
GGCAGGACGACGTTATCCGTGGAGCCGACGACGGGCGTCTTCGTCCTCAAGCCTCAGTCCAAGTTCACGGCGCCG
TACGAGCATCAGTTGAACAATGGCAGAAACGTGGCCGACGACGGCGCGGCCTGTCTGGAGAATGTGCGATGCGCC
GTCATGGAAGACGAGATGCAGCGGCGCGGGAGCATGATGGGATGGAGGGTTCGCAAGCCGCCGCTGACGGTGGAG
GAGACCAAGACGGCGACGAGGCTGCGGACATGGACGAGGGCTCTCTGGCTGCAGAGGGACGGCTGGGGCGCGGGC
TGGTTCATGGCCGTGTTCCTGGGAGCATCGAGCGACGAGTGGTGGCTCGTCGAGGTTTCTGCGGCCGAGGCGGGC
ATCAACCGACGCTCTCCCATGGCAGAGGGCTTCACCAAGGGCGGCGGACGGTCTGTCAAGTTTAAGAGCAAGCTG
CCGCTCCCCAAGGGCCAGCTGGACCTGACGGACGACTTCTGGAGCAAGCTGACGTTGTTCACGACGGGCATGATG
ACGCAGTCGATGGACGTGCGGGAGCTACAGCGACACAAGATTAAGAGCCGGCTGAGCGACGGCACGGATCTATCG
GCTTCACGGCCGGTGCGGCTGCCATCGCTGGAGATTCCGCTATCGGCCGTGTTCCCTTCCATGGCAACGACGACG
CGAGAAGGCGACTTGAGCGCCCAAGACGTCGAGCTGTTCTCGCTGATGCAAAAGTACACGGGCGCGGCTCTGACG
ATGCGACGGGCCTGGGCCGACGACGTGGTGCAGCTCAACTTTGTAGGGATGCGGTCGCGGCCCGATGGCGAGCTC
GTCTGTCTCTCCGAGGCCGTGGTCCGAGTGCGCAAGCGGTCGAGGCTGGCGGCGCTCAAGGACATGGTGGACGGG
GGCGTCGTCTACAGGCCTCGTCGGGGCGAGTTCTCGGTCCAGCTGGAGCGGCGGCTGGGCGAGCCCATGGTGGAG
GCCCTCCGGACGCGCATCAAGGCCGTGGACCGGTTCGTCAACATGGTCGAGGCGCTGGACCGGGCGGGAGGCTCG
CTGTCGACGGAAGAGATGACGCTGGGACGGGTGACGTTTTGCTACGGCGAGGACCGGGCCTGGCGGCTGGAGCTG
GAGCTGTCGTCGGACGAGATGCGCATCTCGGTATCGCCTGGCAACCCTCACCTCCGGGTCATGGACCTGATGAGG
AGGCTGGTCAACAGCGACGGCGGCATCGGCGCCCTGATAGCCTGGCTGCCCGCCTCGCTGCCAGCCCTCCAGGCG
GTATCGGCCATGGAATCCCACTGGGAAGCAGCCGGTTCTCGGGGTCGGCTGACGCTGACGATGAAGTCGCCGGCC
TGGATGATGCTGACGTACGACGTCGTCGACGGGCGCGGACGGCGCCGACGATGA
Gene >Ophun1|6105
ATGCCGATTACGTAAGCGCTCACGTGCCCTTCCTTTTCGCTCCCCTTCTCCCAGCCCCAGAGCCCAAAGCGTCTC
TTTTCGACTCTTCACGCTCGCTCTCGTCCTCCTCCAGCGACTCCCCATCGAGCGGCATGGGCGCAGCTGGCCCGC
AGCCGGCCTCGAGAGGGACACGATGGCGCTGGCCTCCTCCAACAACGGTGACGTCAACAACGGCAACACCAATAA
CAGCAGCAACAACAACAACAACGGCGACGTCAACGCCAGCGCCAACGCCAACGCCAACCTCAACCTCAACCTCAA
CCTCAACCTCAACGGCGCGCGATCGCGAATGAACGACCTGCCAGACGAAATCATCCACATCACCCAGGGCTTCGT
CCCCCTGTCTCTGCTGCTGACGCGCCTGGCTCAGACGTCGCATAATGCCCTCCAAGACAAGATGGCCGAGCTGGC
CAAGATGCCGCTGCCCGCCACCGCCGTCAACGGCAACGCGACGTCGGCCCTCGACGATACCTCGACCGATAACCT
CCGCAAAAAGGCCGCCCTCGCCAGCTTCGCCCAGGACCTCCATGGGAAGTGGCTCAAGGCTCTCGTTATAACAGA
GTGGAGCAGGAAGTCGGACATGGTCAGCAAGCTCATCGACCTCAAGTTCCACATCGATCAGCAGCGCATCCTCTA
CGACGCCTGTCTCGACAACGTCGTCAACGTCAAGCGGGACTTGACTTTTGCGCGCATGCCCAGTCCCGACCTCAA
GACGGCCCTGCAGATTCTCTCCACCGGCACCGCGCCTTGGATGCCCGATGTAAGCCTCCCCTTTTCCCTCATCCG
CCTCCATGCAACACGTCGCTGACCAGACACAGCTCAACTACATCGAACCCCCCCGTCTCACCCCTCGCGAGCAGC
TCAAGTGGATCAGCGATCTCAACACCTTGCTGTCGCTGAGGTTAAATCTCGACGACTACGACAAGATTCCTCCCC
ACTTCAAAGACTACGACATTGCGTCCGGCCGCGTCACCTTCAAGGTTGACGGCGAGTTCCACGTCGACCTTACCA
TTGCCGACGAGGACCTTGAAAAGCAGTATTGGTTCATCGATTTCCGATACGACTTTAGCCCGGCGCCCGCCTCGC
TGTCTCCCGCCCTCAGGGCCTACTTGGAGGGATGCGTCAACGAGGCGCTCAGCAAGGAAGGCCTGGCCGGATGCT
ACCGTTGTCTTCACGAGTTCGTCCTGACGTCCAAGATCAACGAGCTGAAGCGCCAGGCCGTCAAGCTGAGCAGGA
CCTCGTGGACGGGAACCCTCTCGGTGGAGCCGCTCAACCGCGCCCTGGCCATACAGTACTGGACGTCGCGGGCCG
TCACGACGGGGACCAAGAGCTGGATCCTGCTGGCCGTCAACAGCGGACGCAAACCCGACGTCACCGTCCAAGACG
AGAGGGCCACGAGCTTCATCGTGGCCAAGTGGTACCGCAACGGCAAAGAGGTCAAGGACGTCGACGTCGAGCTCG
ACCTCAAGAGACTGTCGGCCGAATCCCTCCTGACGGACGCAATCGGCCGGCACATCGACTCCATCCTGACGAGCG
TCCACGACAAGCTGTTGACGGCGGCGCGCTACAAGGACGGCGAGGCCAGCTTGGTACTGGACCTGTGCCGGTCGG
ATCCGGCGGCGTCTTCGCTGTCGATGCAGGTCGGCAGGACGACGTTATCCGTGGAGCCGACGACGGGCGTCTTCG
TCCTCAAGCCTCAGTCCAAGTTCACGGCGCCGTACGAGCATCAGTTGAACAATGGCAGAAACGTGGCCGACGACG
GCGCGGCCTGTCTGGAGAATGTGCGATGCGCCGTCATGGAAGACGAGATGCAGCGGCGCGGGAGCATGATGGGAT
GGAGGGTTCGCAAGCCGCCGCTGACGGTGGAGGAGACCAAGACGGCGACGAGGCTGCGGACATGGACGAGGGCTC
TCTGGCTGCAGAGGGACGGCTGGGGCGCGGGCTGGTTCATGGCCGTGTTCCTGGGAGCATCGAGCGACGAGTGGT
GGCTCGTCGAGGTTTCTGCGGCCGAGGCGGGCATCAACCGACGCTCTCCCATGGCAGAGGGCTTCACCAAGGGCG
GCGGACGGTCTGTCAAGTTTAAGAGCAAGCTGCCGCTCCCCAAGGGCCAGCTGGACCTGACGGACGACTTCTGGA
GCAAGCTGACGTTGTTCACGACGGGCATGATGACGCAGTCGATGGACGTGCGGGAGCTACAGCGACACAAGATTA
AGAGCCGGCTGAGCGACGGCACGGATCTATCGGCTTCACGGCCGGTGCGGCTGCCATCGCTGGAGATTCCGCTAT
CGGCCGTGTTCCCTTCCATGGCAACGACGACGCGAGAAGGCGACTTGAGCGCCCAAGACGTCGAGCTGTTCTCGC
TGATGCAAAAGTACACGGGCGCGGCTCTGACGATGCGACGGGCCTGGGCCGACGACGTGGTGCAGCTCAACTTTG
TAGGGATGCGGTCGCGGCCCGATGGCGAGCTCGTCTGTCTCTCCGAGGCCGTGGTCCGAGTGCGCAAGCGGTCGA
GGCTGGCGGCGCTCAAGGACATGGTGGACGGGGGCGTCGTCTACAGGCCTCGTCGGGGCGAGTTCTCGGTCCAGC
TGGAGCGGCGGCTGGGCGAGCCCATGGTGGAGGCCCTCCGGACGCGCATCAAGGCCGTGGACCGGTTCGTCAACA
TGGTCGAGGCGCTGGACCGGGCGGGAGGCTCGCTGTCGACGGAAGAGATGACGCTGGGACGGGTGACGTTTTGCT
ACGGCGAGGACCGGGCCTGGCGGCTGGAGCTGGAGCTGTCGTCGGACGAGATGCGCATCTCGGTATCGCCTGGCA
ACCCTCACCTCCGGGTCATGGACCTGATGAGGAGGCTGGTCAACAGCGACGGCGGCATCGGCGCCCTGATAGCCT
GGCTGCCCGCCTCGCTGCCAGCCCTCCAGGCGGTATCGGCCATGGAATCCCACTGGGAAGCAGCCGGTTCTCGGG
GTCGGCTGACGCTGACGATGAAGTCGCCGGCCTGGATGATGCTGACGTACGACGTCGTCGACGGGCGGTCCGTGG
CGTTTGAGGTTCAGATGCGGCGGAGGAGAGGGGAGGCGTGGTGGCACCTCTGGCGAGCGGACGGCGCCGACGATG
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail