Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6104
Gene name
LocationContig_642:9432..10359
Strand+
Gene length (bp)927
Transcript length (bp)801
Coding sequence length (bp)801
Protein length (aa) 267

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 6.5E-09 14 73
PF04193 PQ-loop PQ loop repeat 1.9E-13 184 234

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VCR7|CTNS_DROME Cystinosin homolog OS=Drosophila melanogaster GN=CG17119 PE=1 SV=2 15 264 7.0E-41
sp|Q54WT7|CTNS_DICDI Cystinosin homolog OS=Dictyostelium discoideum GN=ctns PE=3 SV=1 19 264 4.0E-38
sp|Q09500|CTNS_CAEEL Cystinosin homolog OS=Caenorhabditis elegans GN=ctns-1 PE=3 SV=2 9 264 2.0E-37
sp|A8WN56|CTNS_CAEBR Cystinosin homolog OS=Caenorhabditis briggsae GN=ctns-1 PE=3 SV=1 17 264 7.0E-37
sp|A7MB63|CTNS_BOVIN Cystinosin OS=Bos taurus GN=CTNS PE=2 SV=1 14 264 4.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VCR7|CTNS_DROME Cystinosin homolog OS=Drosophila melanogaster GN=CG17119 PE=1 SV=2 15 264 7.0E-41
sp|Q54WT7|CTNS_DICDI Cystinosin homolog OS=Dictyostelium discoideum GN=ctns PE=3 SV=1 19 264 4.0E-38
sp|Q09500|CTNS_CAEEL Cystinosin homolog OS=Caenorhabditis elegans GN=ctns-1 PE=3 SV=2 9 264 2.0E-37
sp|A8WN56|CTNS_CAEBR Cystinosin homolog OS=Caenorhabditis briggsae GN=ctns-1 PE=3 SV=1 17 264 7.0E-37
sp|A7MB63|CTNS_BOVIN Cystinosin OS=Bos taurus GN=CTNS PE=2 SV=1 14 264 4.0E-35
sp|O60931|CTNS_HUMAN Cystinosin OS=Homo sapiens GN=CTNS PE=1 SV=2 14 264 9.0E-34
sp|P57757|CTNS_MOUSE Cystinosin OS=Mus musculus GN=Ctns PE=1 SV=1 14 264 9.0E-32
sp|P57758|CTNS_ARATH Cystinosin homolog OS=Arabidopsis thaliana GN=At5g40670 PE=2 SV=1 19 264 4.0E-27
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 13 32 19
2 52 74 22
3 94 113 19
4 128 150 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6104
METASDGDEFLRGVSTLFGWVYTLAWSASFYAQPVLNFRRGATAGSTVDFPFLNVLGFAAYLASNTALYYSPLIR
AQYAARNNGTPPTVQFNDLTFALHALVLSSLTTSQYLLRRAWGFAPAPGTKPARLVVGIAAGCLVALLLTYVRVA
TDEGFRGGGEEGGPRWVLAAADPAAMGWCELDLVYAAGYVKLIITLVKYTPQMLANARNRSTAGWSIWQILLDVV
GGVLSVAQQAVDSYVLRDWSGITGNPVKFALGNASLLFDSA*
Coding >Ophun1|6104
ATGGAGACGGCGAGCGACGGCGATGAATTCCTGCGCGGGGTTTCGACTCTGTTTGGATGGGTCTATACCCTGGCT
TGGAGTGCGTCGTTTTATGCGCAGCCTGTGCTCAACTTTCGGAGGGGGGCTACGGCTGGGTCGACGGTTGACTTT
CCCTTTCTCAACGTTCTAGGCTTCGCCGCATATCTCGCCTCCAACACCGCCCTCTACTACTCCCCCCTCATCCGC
GCCCAATACGCAGCCCGCAACAACGGCACCCCCCCAACCGTCCAATTCAACGACCTCACCTTCGCCCTCCACGCC
CTCGTCCTCTCCTCCCTCACCACATCGCAATACCTCCTCCGCCGAGCCTGGGGATTCGCCCCCGCGCCCGGCACC
AAGCCCGCCCGCCTCGTCGTCGGCATCGCTGCCGGCTGCCTCGTCGCCCTGCTGCTGACCTACGTGCGCGTCGCC
ACGGACGAGGGTTTCCGCGGCGGGGGGGAGGAGGGGGGCCCGCGGTGGGTGCTCGCTGCTGCGGATCCCGCGGCC
ATGGGGTGGTGCGAGCTCGATCTCGTGTACGCGGCCGGCTACGTGAAGCTCATCATCACGCTGGTGAAGTACACG
CCGCAGATGCTGGCCAACGCGCGGAATCGGAGCACGGCTGGCTGGAGTATCTGGCAGATCCTGCTGGATGTCGTG
GGAGGGGTGCTGAGCGTGGCGCAGCAGGCGGTGGATAGCTATGTGCTGCGCGACTGGTCGGGCATCACGGGCAAT
CCTGTCAAGTTTGCGCTGGGGAATGCGAGCTTGCTGTTTGATTCGGCATGA
Transcript >Ophun1|6104
ATGGAGACGGCGAGCGACGGCGATGAATTCCTGCGCGGGGTTTCGACTCTGTTTGGATGGGTCTATACCCTGGCT
TGGAGTGCGTCGTTTTATGCGCAGCCTGTGCTCAACTTTCGGAGGGGGGCTACGGCTGGGTCGACGGTTGACTTT
CCCTTTCTCAACGTTCTAGGCTTCGCCGCATATCTCGCCTCCAACACCGCCCTCTACTACTCCCCCCTCATCCGC
GCCCAATACGCAGCCCGCAACAACGGCACCCCCCCAACCGTCCAATTCAACGACCTCACCTTCGCCCTCCACGCC
CTCGTCCTCTCCTCCCTCACCACATCGCAATACCTCCTCCGCCGAGCCTGGGGATTCGCCCCCGCGCCCGGCACC
AAGCCCGCCCGCCTCGTCGTCGGCATCGCTGCCGGCTGCCTCGTCGCCCTGCTGCTGACCTACGTGCGCGTCGCC
ACGGACGAGGGTTTCCGCGGCGGGGGGGAGGAGGGGGGCCCGCGGTGGGTGCTCGCTGCTGCGGATCCCGCGGCC
ATGGGGTGGTGCGAGCTCGATCTCGTGTACGCGGCCGGCTACGTGAAGCTCATCATCACGCTGGTGAAGTACACG
CCGCAGATGCTGGCCAACGCGCGGAATCGGAGCACGGCTGGCTGGAGTATCTGGCAGATCCTGCTGGATGTCGTG
GGAGGGGTGCTGAGCGTGGCGCAGCAGGCGGTGGATAGCTATGTGCTGCGCGACTGGTCGGGCATCACGGGCAAT
CCTGTCAAGTTTGCGCTGGGGAATGCGAGCTTGCTGTTTGATTCGGCATGA
Gene >Ophun1|6104
ATGGAGACGGCGAGCGACGGCGATGAATTCCTGCGCGGGGTTTCGACTCTGTTTGGATGGGTCTATACCCTGGCT
TGGAGTGCGTCGTTTTATGCGCAGCCTGTGCTCAACTTTCGGAGGGGGGCTACGGCTGGGTCGACGGTTGACTTT
CCCTTTCTCAACGTTCTAGGTAACCCTCACCCCGAATCAAAAGAAACCACCATCCCTGGGCCAGATATCTAGCTA
ACGACCAAATAAAATCCATCTAGGCTTCGCCGCATATCTCGCCTCCAACACCGCCCTCTACTACTCCCCCCTCAT
CCGCGCCCAATACGCAGCCCGCAACAACGGCACCCCCCCAACCGTCCAATTCAACGACCTCACCTTCGCCCTCCA
CGCCCTCGTCCTCTCCTCCCTCACCACATCGCAATACCTCCTCCGCCGAGCCTGGGGATTCGCCCCCGCGCCCGG
CACCAAGCCCGCCCGCCTCGTCGTCGGCATCGCTGCCGGCTGCCTCGTCGCCCTGCTGCTGACCTACGTGCGCGT
CGCCACGGACGAGGGTTTCCGCGGCGGGGGGGAGGAGGGGGGCCCGCGGTGGGTGCTCGCTGCTGCGGATCCCGC
GGCCATGGGGTGGTGCGAGCTCGATCTCGTGTACGCGGCCGGCTACGTGAAGCTCATCATCACGCTGGTGAAGTA
CACGCCGCAGATGCTGGCCAACGCGCGGAATCGGAGCACGGCTGGCTGGAGTATCTGGCAGATCCTGCTGGATGT
CGTGGGAGGGGTGCTGAGCGTGGCGCAGCAGGCGGTGGATAGCTATGTGCTGCGCGACTGGTCGGGCATCACGGG
CAATCCTGTCAAGTTTGCGCTGGGGAATGCGAGCTTGCTGTTTGATTCGGTGTTTGTGGCTCAGCATTTTGTGCT
GTATCCTGAGGGGGGGGGGAGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail