Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6097
Gene name
LocationContig_640:8095..10322
Strand-
Gene length (bp)2227
Transcript length (bp)2103
Coding sequence length (bp)2103
Protein length (aa) 701

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 5.3E-171 4 653

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 1 700 0.0E+00
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 1 678 9.0E-179
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 1 691 1.0E-154
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 1 691 2.0E-154
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 1 691 3.0E-150
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 1 700 0.0E+00
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 1 678 9.0E-179
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 1 691 1.0E-154
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 1 691 2.0E-154
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 1 691 3.0E-150
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 1 691 3.0E-150
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 1 691 2.0E-147
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 1 695 3.0E-145
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 1 683 1.0E-143
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 2 683 2.0E-141
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 3 680 2.0E-140
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 1 684 2.0E-135
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 1 672 2.0E-112
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 1 687 1.0E-94
[Show less]

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0042887 amide transmembrane transporter activity No
GO:1904680 peptide transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 5 26 21
2 33 55 22
3 79 101 22
4 113 132 19
5 136 158 22
6 179 210 31
7 225 247 22
8 252 274 22
9 326 348 22
10 378 400 22
11 404 426 22
12 452 474 22
13 489 511 22
14 556 578 22
15 604 623 19
16 636 658 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6097
MPVNTIRAWVIGSVLCTMVAACNILLNLRRTPISITSTVVQLVAYPIGVGWSRVMPDVSFTLFGHKLSLNPGPFN
VKEHTLITMMTAAGSSISYSIDILLAQEIFYKQEFKWGFQILLMLSTQAMGFGIAGVARRFLVWPSSMVWPATLI
TCSVMYSLHDHRPSDPAETNGWRIGRYKFFLYVALVTFAWEWFPLVIAPFLSLFMFVTWIAPTNVVVNQIFGGQS
GLGLLPISFDWSTITAFLLSPLQTPAFAIFNVFAGIMLTTIGAIGLAWAGPEFYRYLPLSANQNYDRFAQPYNTS
RILTPDFVINETAYQAYSPILLGPTFSLSYGLSFATLISTITHVALFYGHDVWNRARDSKYEEPDVHLKLMRKYR
ECPEWWFMSIFAVSFAFGMIASQFWKTNLTWWAYIVCILIGVVLFIPIGMVQAITNQQTGLNVITEMIIGYMMPG
RPVAMMLFKSWGYMLSYNGLTYISDMKVGHYMKIPPRSMFAAQAFAVIWLSFVQISTYNFLRGNIEGICTPTQAQ
GLTCPNARTFYNASVIWGVIGPRKVFGAGSIYAWTNWFWFIGFAVPVIQWFAARRWPRSWVRYLVSPALFGAAGM
MPPATLFYLFQWVIVGLIFNYFIRRRFFGWWTRYNYPLSGALDIGTALCTVVAGLGLGLSETQFPTWWGTTVVGN
TLDANNTAVTKVFVEGQQPIGPSSW*
Coding >Ophun1|6097
ATGCCCGTCAACACGATCCGCGCCTGGGTCATCGGCAGCGTGCTCTGCACCATGGTGGCCGCCTGCAATATCCTG
CTCAACCTCCGGCGGACGCCCATCTCCATCACCTCGACCGTGGTGCAGCTGGTGGCCTACCCCATCGGTGTCGGC
TGGAGTCGCGTCATGCCCGACGTGTCCTTCACCCTCTTCGGTCACAAGCTGTCCCTCAACCCCGGCCCCTTCAAC
GTCAAGGAGCACACGCTCATCACCATGATGACGGCCGCCGGCTCCAGCATCAGCTACTCCATCGACATCCTACTC
GCCCAGGAAATCTTCTACAAGCAAGAATTCAAATGGGGCTTCCAGATCCTGCTCATGCTCTCCACCCAGGCAATG
GGCTTCGGCATCGCCGGTGTCGCCCGCCGCTTCCTCGTCTGGCCCTCATCCATGGTATGGCCCGCGACGCTCATC
ACCTGCTCCGTCATGTACTCGCTGCACGACCACCGACCCTCGGATCCGGCAGAGACCAATGGCTGGCGTATTGGC
CGCTACAAGTTCTTCCTCTACGTCGCCCTCGTCACCTTTGCTTGGGAATGGTTCCCCCTCGTCATTGCCCCCTTC
CTGTCGCTCTTCATGTTCGTCACCTGGATCGCGCCCACAAACGTCGTCGTCAACCAGATCTTCGGCGGTCAATCG
GGCCTTGGCCTGCTACCCATCTCGTTCGATTGGTCAACCATCACCGCCTTCCTGTTGTCGCCGCTGCAGACGCCC
GCCTTTGCCATCTTCAACGTCTTCGCCGGCATCATGCTCACCACCATCGGCGCCATTGGCCTCGCCTGGGCCGGA
CCCGAGTTCTACCGTTACCTGCCGCTCAGCGCCAACCAGAACTATGACCGCTTCGCTCAGCCCTACAACACCAGC
CGCATCCTGACACCCGACTTCGTCATCAATGAGACGGCCTACCAGGCCTACTCACCCATCCTGCTGGGGCCGACC
TTTTCCCTCTCGTACGGCCTGTCCTTTGCCACGCTCATCTCCACAATCACCCACGTCGCCCTCTTCTACGGACAC
GACGTCTGGAACCGCGCGCGCGACTCCAAGTACGAGGAGCCAGATGTGCACCTCAAGCTGATGCGCAAGTACCGC
GAGTGTCCCGAGTGGTGGTTCATGTCCATCTTCGCCGTCAGCTTCGCCTTTGGCATGATTGCCAGCCAGTTCTGG
AAGACCAACCTCACCTGGTGGGCCTACATCGTCTGTATCCTCATCGGCGTCGTCCTCTTCATCCCCATCGGCATG
GTTCAGGCCATCACCAACCAGCAGACGGGCCTCAACGTCATCACCGAGATGATTATTGGCTACATGATGCCCGGT
CGCCCCGTCGCCATGATGCTCTTCAAGTCGTGGGGCTACATGCTGTCCTACAACGGCCTGACGTACATCTCCGAC
ATGAAGGTCGGCCACTACATGAAGATTCCGCCCCGGAGCATGTTCGCCGCCCAGGCCTTTGCCGTCATCTGGCTG
TCCTTTGTCCAGATCTCCACCTACAACTTCTTGCGCGGCAACATCGAGGGCATCTGCACCCCGACGCAGGCCCAG
GGCCTGACGTGCCCCAACGCCAGGACGTTTTACAACGCCAGCGTCATCTGGGGCGTCATCGGGCCCCGCAAGGTC
TTTGGCGCCGGCAGCATCTACGCCTGGACCAACTGGTTCTGGTTCATCGGCTTCGCCGTGCCCGTCATCCAGTGG
TTCGCCGCCCGCCGTTGGCCCCGGTCCTGGGTCCGTTACCTCGTCTCGCCCGCCCTGTTCGGCGCCGCCGGCATG
ATGCCGCCCGCCACGCTCTTCTACCTGTTCCAGTGGGTCATCGTCGGCCTCATCTTTAACTATTTCATCCGCAGA
CGCTTCTTTGGCTGGTGGACTCGCTACAACTATCCTCTCTCCGGTGCCCTCGACATCGGTACCGCCCTGTGTACC
GTTGTCGCCGGCCTCGGCCTCGGTCTCAGCGAGACGCAGTTCCCGACGTGGTGGGGGACCACCGTCGTCGGCAAC
ACGCTTGACGCCAACAACACGGCCGTCACAAAGGTCTTTGTGGAGGGGCAGCAGCCCATCGGGCCGTCGAGCTGG
TAG
Transcript >Ophun1|6097
ATGCCCGTCAACACGATCCGCGCCTGGGTCATCGGCAGCGTGCTCTGCACCATGGTGGCCGCCTGCAATATCCTG
CTCAACCTCCGGCGGACGCCCATCTCCATCACCTCGACCGTGGTGCAGCTGGTGGCCTACCCCATCGGTGTCGGC
TGGAGTCGCGTCATGCCCGACGTGTCCTTCACCCTCTTCGGTCACAAGCTGTCCCTCAACCCCGGCCCCTTCAAC
GTCAAGGAGCACACGCTCATCACCATGATGACGGCCGCCGGCTCCAGCATCAGCTACTCCATCGACATCCTACTC
GCCCAGGAAATCTTCTACAAGCAAGAATTCAAATGGGGCTTCCAGATCCTGCTCATGCTCTCCACCCAGGCAATG
GGCTTCGGCATCGCCGGTGTCGCCCGCCGCTTCCTCGTCTGGCCCTCATCCATGGTATGGCCCGCGACGCTCATC
ACCTGCTCCGTCATGTACTCGCTGCACGACCACCGACCCTCGGATCCGGCAGAGACCAATGGCTGGCGTATTGGC
CGCTACAAGTTCTTCCTCTACGTCGCCCTCGTCACCTTTGCTTGGGAATGGTTCCCCCTCGTCATTGCCCCCTTC
CTGTCGCTCTTCATGTTCGTCACCTGGATCGCGCCCACAAACGTCGTCGTCAACCAGATCTTCGGCGGTCAATCG
GGCCTTGGCCTGCTACCCATCTCGTTCGATTGGTCAACCATCACCGCCTTCCTGTTGTCGCCGCTGCAGACGCCC
GCCTTTGCCATCTTCAACGTCTTCGCCGGCATCATGCTCACCACCATCGGCGCCATTGGCCTCGCCTGGGCCGGA
CCCGAGTTCTACCGTTACCTGCCGCTCAGCGCCAACCAGAACTATGACCGCTTCGCTCAGCCCTACAACACCAGC
CGCATCCTGACACCCGACTTCGTCATCAATGAGACGGCCTACCAGGCCTACTCACCCATCCTGCTGGGGCCGACC
TTTTCCCTCTCGTACGGCCTGTCCTTTGCCACGCTCATCTCCACAATCACCCACGTCGCCCTCTTCTACGGACAC
GACGTCTGGAACCGCGCGCGCGACTCCAAGTACGAGGAGCCAGATGTGCACCTCAAGCTGATGCGCAAGTACCGC
GAGTGTCCCGAGTGGTGGTTCATGTCCATCTTCGCCGTCAGCTTCGCCTTTGGCATGATTGCCAGCCAGTTCTGG
AAGACCAACCTCACCTGGTGGGCCTACATCGTCTGTATCCTCATCGGCGTCGTCCTCTTCATCCCCATCGGCATG
GTTCAGGCCATCACCAACCAGCAGACGGGCCTCAACGTCATCACCGAGATGATTATTGGCTACATGATGCCCGGT
CGCCCCGTCGCCATGATGCTCTTCAAGTCGTGGGGCTACATGCTGTCCTACAACGGCCTGACGTACATCTCCGAC
ATGAAGGTCGGCCACTACATGAAGATTCCGCCCCGGAGCATGTTCGCCGCCCAGGCCTTTGCCGTCATCTGGCTG
TCCTTTGTCCAGATCTCCACCTACAACTTCTTGCGCGGCAACATCGAGGGCATCTGCACCCCGACGCAGGCCCAG
GGCCTGACGTGCCCCAACGCCAGGACGTTTTACAACGCCAGCGTCATCTGGGGCGTCATCGGGCCCCGCAAGGTC
TTTGGCGCCGGCAGCATCTACGCCTGGACCAACTGGTTCTGGTTCATCGGCTTCGCCGTGCCCGTCATCCAGTGG
TTCGCCGCCCGCCGTTGGCCCCGGTCCTGGGTCCGTTACCTCGTCTCGCCCGCCCTGTTCGGCGCCGCCGGCATG
ATGCCGCCCGCCACGCTCTTCTACCTGTTCCAGTGGGTCATCGTCGGCCTCATCTTTAACTATTTCATCCGCAGA
CGCTTCTTTGGCTGGTGGACTCGCTACAACTATCCTCTCTCCGGTGCCCTCGACATCGGTACCGCCCTGTGTACC
GTTGTCGCCGGCCTCGGCCTCGGTCTCAGCGAGACGCAGTTCCCGACGTGGTGGGGGACCACCGTCGTCGGCAAC
ACGCTTGACGCCAACAACACGGCCGTCACAAAGGTCTTTGTGGAGGGGCAGCAGCCCATCGGGCCGTCGAGCTGG
TAG
Gene >Ophun1|6097
ATGCCCGTCAACACGATCCGCGCCTGGGTCATCGGCAGCGTGCTCTGCACCATGGTGGCCGCCTGCAATATCCTG
CTCAACCTCCGGCGGACGCCCATCTCCATCACCTCGACCGTGGTGCAGCTGGTGGCCTACCCGTGAGATCTCTAT
CCTCCCCGATACGCCTGTCCTCTCGTCTGACCCGTCCAGCATCGGTGTCGGCTGGAGTCGCGTCATGCCCGACGT
GTCCTTCACCCTCTTCGGTCACAAGCTGTCCCTCAACCCCGGCCCCTTCAACGTCAAGGAGCACACGCTCATCAC
CATGATGACGGCCGCCGGCTCCAGCATCAGCTACTCCATCGACATCCTACTCGCCCAGGAAATCTTCTACAAGCA
AGAATTCAAATGGGGCTTCCAGATCCTGCTCATGCTCTCCACCCAGGCAATGGGCTTCGGCATCGCCGGTGTCGC
CCGCCGCTTCCTCGTCTGGCCCTCATCCATGGTATGGCCCGCGACGCTCATCACCTGCTCCGTCATGTACTCGCT
GCACGACCACCGACCCTCGGATCCGGCAGAGACCAATGGCTGGCGTATTGGCCGCTACAAGTTCTTCCTCTACGT
CGCCCTCGTCACCTTTGCTTGGGAATGGTTCCCCCTCGTCATTGCCCCCTTCCTGTCGCTCTTCATGTTCGTCAC
CTGGATCGCGCCCACAAACGTCGTCGTCAACCAGATCTTCGGCGGTCAATCGGGCCTTGGCCTGCTACCCATCTC
GTTCGATTGGTCAACCATCACCGCCTTCCTGTTGTCGCCGCTGCAGACGCCCGCCTTTGCCATCTTCAACGTCTT
CGCCGGCATCATGCTCACCACCATCGGCGCCATTGGCCTCGCCTGGGCCGGACCCGAGTTCTACCGTTACCTGCC
GCTCAGCGCCAACCAGAACTATGACCGCTTCGCTCAGCCCTACAACACCAGCCGCATCCTGACACCCGACTTCGT
CATCAATGAGACGGCCTACCAGGCCTACTCACCCATCCTGCTGGGGCCGACCTTTTCCCTCTCGTACGGCCTGTC
CTTTGCCACGCTCATCTCCACAATCACCCACGTCGCCCTCTTCTACGGACACGACGTCTGGAACCGCGCGCGCGA
CTCCAAGTACGAGGAGCCAGATGTGCACCTCAAGCTGATGCGCAAGTACCGCGAGTGTCCCGAGTGGTGGTTCAT
GTCCATCTTCGCCGTCAGCTTCGCCTTTGGCATGATTGCCAGCCAGTTCTGGAAGACCAACCTCACCTGGTGGGC
CTACATCGTCTGTATCCTCATCGGCGTCGTCCTCTTCATCCCCATCGGCATGGTTCAGGCCATCACCAACCAGCA
GACGGGCCTCAACGTCATCACCGAGATGATTATTGGCTACATGATGCCCGGTCGCCCCGTCGCCATGATGCTCTT
CAAGTCGTGGGGCTACATGCTGTCCTACAACGGCCTGACGTACATCTCCGACATGAAGGTCGGCCACTACATGAA
GATTCCGCCCCGGAGCATGTTCGCCGCCCAGGCCTTTGCCGTCATCTGGCTGTCCTTTGTCCAGATCTCCACCTA
CAACTTCTTGCGCGGCAACATCGAGGGCATCTGCACCCCGACGCAGGCCCAGGGCCTGACGTGCCCCAACGCCAG
GACGTTTTACAACGCCAGCGTCATCTGGGGCGTCATCGGGCCCCGCAAGGTCTTTGGCGCCGGCAGCATCTACGC
CTGGACCAACTGGTTCTGGTTCATCGGCTTCGCCGTGCCCGTCATCCAGTGGTTCGCCGCCCGCCGTTGGCCCCG
GTCCTGGGTCCGTTACCTCGTCTCGCCCGCCCTGTTCGGCGCCGCCGGCATGATGCCGCCCGCCACGCTCTTCTA
CCTGTTCCAGTGGGTCATCGTCGGCCTCATCTTTAACTATTTCATCCGCAGACGCTTCTTTGGCTGGTGGAGTAA
GCAGCTTCCTATCTCCTTTCTCCTCTCCTCGAACCTTTTTGTTCGTTTTGCTCACTCTTTTCCTCCAGCTCGCTA
CAACTATCCTCTCTCCGGTGCCCTCGACATCGGTACCGCCCTGTGTACCGTTGTCGCCGGCCTCGGCCTCGGTCT
CAGCGAGACGCAGTTCCCGACGTGGTGGGGGACCACCGTCGTCGGCAACACGCTTGACGCCAACAACACGGCCGT
CACAAAGGTCTTTGTGGAGGGGCAGCAGCCCATCGGGCCGTCGAGCTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail