Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6096
Gene name
LocationContig_640:6718..7414
Strand-
Gene length (bp)696
Transcript length (bp)486
Coding sequence length (bp)486
Protein length (aa) 162

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01849 NAC NAC domain 5.9E-23 47 102

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H4X9|NACB_CHAGB Nascent polypeptide-associated complex subunit beta OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=EGD1 PE=3 SV=1 1 161 3.0E-88
sp|Q7SDU4|NACB_NEUCR Nascent polypeptide-associated complex subunit beta OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=npc-2 PE=3 SV=2 1 161 6.0E-87
sp|A4RC23|NACB_MAGO7 Nascent polypeptide-associated complex subunit beta OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=EGD1 PE=3 SV=2 1 161 2.0E-85
sp|Q4I283|NACB_GIBZE Nascent polypeptide-associated complex subunit beta OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=EGD1 PE=3 SV=2 1 157 2.0E-80
sp|A6R5Z3|NACB_AJECN Nascent polypeptide-associated complex subunit beta OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=EGD1 PE=3 SV=1 5 161 2.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H4X9|NACB_CHAGB Nascent polypeptide-associated complex subunit beta OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=EGD1 PE=3 SV=1 1 161 3.0E-88
sp|Q7SDU4|NACB_NEUCR Nascent polypeptide-associated complex subunit beta OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=npc-2 PE=3 SV=2 1 161 6.0E-87
sp|A4RC23|NACB_MAGO7 Nascent polypeptide-associated complex subunit beta OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=EGD1 PE=3 SV=2 1 161 2.0E-85
sp|Q4I283|NACB_GIBZE Nascent polypeptide-associated complex subunit beta OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=EGD1 PE=3 SV=2 1 157 2.0E-80
sp|A6R5Z3|NACB_AJECN Nascent polypeptide-associated complex subunit beta OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=EGD1 PE=3 SV=1 5 161 2.0E-77
sp|A1CMP1|NACB_ASPCL Nascent polypeptide-associated complex subunit beta OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=egd1 PE=3 SV=1 5 161 5.0E-77
sp|A1DL98|NACB_NEOFI Nascent polypeptide-associated complex subunit beta OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=egd1 PE=3 SV=1 28 161 4.0E-75
sp|Q4WCX4|NACB_ASPFU Nascent polypeptide-associated complex subunit beta OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=egd1 PE=3 SV=1 5 161 6.0E-75
sp|A2R091|NACB_ASPNC Nascent polypeptide-associated complex subunit beta OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=egd1 PE=3 SV=1 5 161 3.0E-73
sp|Q0CGL5|NACB_ASPTN Nascent polypeptide-associated complex subunit beta OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=egd1 PE=3 SV=1 5 161 5.0E-71
sp|Q1DI23|NACB_COCIM Nascent polypeptide-associated complex subunit beta OS=Coccidioides immitis (strain RS) GN=EGD1 PE=3 SV=1 5 161 4.0E-70
sp|A6S6B0|NACB_BOTFB Nascent polypeptide-associated complex subunit beta OS=Botryotinia fuckeliana (strain B05.10) GN=egd1 PE=3 SV=1 28 161 1.0E-69
sp|A7F9B8|NACB_SCLS1 Nascent polypeptide-associated complex subunit beta OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=egd1 PE=3 SV=1 28 161 1.0E-69
sp|Q5ASI4|NACB_EMENI Nascent polypeptide-associated complex subunit beta OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=egd1 PE=3 SV=1 5 161 3.0E-68
sp|Q2U6N1|NACB_ASPOR Nascent polypeptide-associated complex subunit beta OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=egd1 PE=3 SV=1 28 161 6.0E-68
sp|Q0ULD0|NACB_PHANO Nascent polypeptide-associated complex subunit beta OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=EGD1 PE=3 SV=1 5 161 9.0E-68
sp|Q4P9Y9|NACB_USTMA Nascent polypeptide-associated complex subunit beta OS=Ustilago maydis (strain 521 / FGSC 9021) GN=EGD1 PE=3 SV=1 5 134 2.0E-50
sp|P0CP08|NACB_CRYNJ Nascent polypeptide-associated complex subunit beta OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=EGD1 PE=3 SV=1 5 157 4.0E-50
sp|P0CP09|NACB_CRYNB Nascent polypeptide-associated complex subunit beta OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=EGD1 PE=3 SV=1 5 157 4.0E-50
sp|Q92371|NACB_SCHPO Nascent polypeptide-associated complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btf3 PE=2 SV=2 7 152 8.0E-45
sp|Q64152|BTF3_MOUSE Transcription factor BTF3 OS=Mus musculus GN=Btf3 PE=1 SV=3 5 161 7.0E-43
sp|P20290|BTF3_HUMAN Transcription factor BTF3 OS=Homo sapiens GN=BTF3 PE=1 SV=1 5 161 1.0E-42
sp|Q18885|BTF3_CAEEL Transcription factor BTF3 homolog OS=Caenorhabditis elegans GN=icd-1 PE=1 SV=1 4 151 3.0E-40
sp|Q6PC91|BT3L4_DANRE Transcription factor BTF3 homolog 4 OS=Danio rerio GN=btf3l4 PE=2 SV=1 5 161 7.0E-40
sp|Q5M8V0|BT3L4_XENTR Transcription factor BTF3 homolog 4 OS=Xenopus tropicalis GN=btf3l4 PE=2 SV=1 5 131 2.0E-38
sp|Q4KLF5|BT3L4_XENLA Transcription factor BTF3 homolog 4 OS=Xenopus laevis GN=btf3l4 PE=2 SV=1 5 131 2.0E-38
sp|Q2KIY7|BT3L4_BOVIN Transcription factor BTF3 homolog 4 OS=Bos taurus GN=BTF3L4 PE=2 SV=1 5 161 2.0E-38
sp|Q5RC59|BT3L4_PONAB Transcription factor BTF3 homolog 4 OS=Pongo abelii GN=BTF3L4 PE=2 SV=1 5 161 3.0E-38
sp|Q9CQH7|BT3L4_MOUSE Transcription factor BTF3 homolog 4 OS=Mus musculus GN=Btf3l4 PE=1 SV=1 5 161 3.0E-38
sp|Q96K17|BT3L4_HUMAN Transcription factor BTF3 homolog 4 OS=Homo sapiens GN=BTF3L4 PE=1 SV=1 5 161 3.0E-38
sp|Q5ZJG3|BT3L4_CHICK Transcription factor BTF3 homolog 4 OS=Gallus gallus GN=BTF3L4 PE=2 SV=1 5 157 4.0E-38
sp|Q6C2F3|NACB_YARLI Nascent polypeptide-associated complex subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EGD1 PE=3 SV=1 28 161 3.0E-32
sp|Q6FKD1|NACB_CANGA Nascent polypeptide-associated complex subunit beta OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=EGD1 PE=3 SV=1 7 161 3.0E-26
sp|Q751F1|NACB_ASHGO Nascent polypeptide-associated complex subunit beta OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EGD1 PE=3 SV=1 16 161 1.0E-24
sp|Q6BLV1|NACB_DEBHA Nascent polypeptide-associated complex subunit beta OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EGD1 PE=3 SV=1 30 157 5.0E-24
sp|Q54TR8|NACB_DICDI Nascent polypeptide-associated complex subunit beta OS=Dictyostelium discoideum GN=nacB PE=3 SV=1 15 159 1.0E-23
sp|A5DF06|NACB_PICGU Nascent polypeptide-associated complex subunit beta OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=EGD1 PE=3 SV=2 6 157 3.0E-23
sp|Q02642|NACB1_YEAST Nascent polypeptide-associated complex subunit beta-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EGD1 PE=1 SV=2 16 161 6.0E-22
sp|A6ZWL1|NACB1_YEAS7 Nascent polypeptide-associated complex subunit beta-1 OS=Saccharomyces cerevisiae (strain YJM789) GN=EGD1 PE=3 SV=1 16 161 6.0E-22
sp|A5DT59|NACB_LODEL Nascent polypeptide-associated complex subunit beta OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=EGD1 PE=3 SV=1 30 152 9.0E-21
sp|A3GHR2|NACB_PICST Nascent polypeptide-associated complex subunit beta OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=EGD1 PE=3 SV=1 30 157 2.0E-20
sp|Q59TU0|NACB_CANAL Nascent polypeptide-associated complex subunit beta OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EGD1 PE=3 SV=1 30 152 7.0E-18
sp|Q6CR46|NACB_KLULA Nascent polypeptide-associated complex subunit beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=EGD1 PE=3 SV=1 5 161 7.0E-17
sp|P40314|NACB2_YEAST Nascent polypeptide-associated complex subunit beta-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BTT1 PE=1 SV=1 5 135 3.0E-11
sp|A6ZYK4|NACB2_YEAS7 Nascent polypeptide-associated complex subunit beta-2 OS=Saccharomyces cerevisiae (strain YJM789) GN=BTT1 PE=3 SV=1 5 135 3.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6096
MADIQERLKKLPQGARIGYVCELSLRCGKGTPRRKVKRTPARSGADDKKLQQTLKKLNTQPIQAIEEVNMFKADG
NVIHFAAPKVHAAVPANTFAIYGNGEDKELTELVPGILNQLGRDSLASLRKLAESYQNMQKGEKGEDDDDEIPDL
VEGENFESKVE*
Coding >Ophun1|6096
ATGGCCGATATTCAGGAGCGTCTTAAGAAGCTTCCTCAGGGAGCGCGAATCGGGTATGTTTGCGAGCTGAGCCTT
CGATGTGGCAAGGGAACGCCTCGGAGAAAGGTCAAGCGCACGCCTGCCCGGTCCGGCGCCGACGACAAGAAGCTC
CAGCAGACGCTCAAGAAGCTCAATACGCAGCCCATCCAGGCGATCGAGGAGGTCAACATGTTCAAGGCTGACGGC
AATGTGATTCACTTTGCTGCTCCCAAGGTTCACGCGGCCGTCCCCGCCAACACGTTTGCCATCTACGGGAATGGT
GAGGATAAGGAGCTTACGGAGCTCGTTCCTGGCATTCTGAATCAGCTTGGCCGTGACTCGCTCGCTTCGCTGCGC
AAGCTGGCTGAGAGCTATCAGAACATGCAAAAGGGCGAAAAGGGCGAAGATGACGACGACGAGATTCCAGATCTG
GTTGAGGGTGAGAACTTTGAGAGCAAGGTCGAGTAG
Transcript >Ophun1|6096
ATGGCCGATATTCAGGAGCGTCTTAAGAAGCTTCCTCAGGGAGCGCGAATCGGGTATGTTTGCGAGCTGAGCCTT
CGATGTGGCAAGGGAACGCCTCGGAGAAAGGTCAAGCGCACGCCTGCCCGGTCCGGCGCCGACGACAAGAAGCTC
CAGCAGACGCTCAAGAAGCTCAATACGCAGCCCATCCAGGCGATCGAGGAGGTCAACATGTTCAAGGCTGACGGC
AATGTGATTCACTTTGCTGCTCCCAAGGTTCACGCGGCCGTCCCCGCCAACACGTTTGCCATCTACGGGAATGGT
GAGGATAAGGAGCTTACGGAGCTCGTTCCTGGCATTCTGAATCAGCTTGGCCGTGACTCGCTCGCTTCGCTGCGC
AAGCTGGCTGAGAGCTATCAGAACATGCAAAAGGGCGAAAAGGGCGAAGATGACGACGACGAGATTCCAGATCTG
GTTGAGGGTGAGAACTTTGAGAGCAAGGTCGAGTAG
Gene >Ophun1|6096
ATGGCCGATATTCAGGAGCGTCTTAAGAAGCTTCCTCAGGGAGCGCGAATCGGTGAGTTGGAAAATTCTCCGCTT
TCTGTTGCGTGGAAGCTTTTGTGGATGGGGGCTGACGTCTGTTGCTAGGGTATGTTTGCGAGCTGAGCCTTCGAT
GGTTTCGTTTCCGGATTCGTCGTCGCTAACGCGTCGTTTTCTTGCGCGTTGCCAGTGGCAAGGGAACGCCTCGGA
GAAAGGTCAAGCGCACGCCTGCCCGGTCCGGCGCCGACGACAAGAAGCTCCAGCAGACGCTCAAGAAGCTCAATA
CGCAGCCCATCCAGGCGATCGAGGAGGTCAACATGTTCAAGGCTGACGGCAATGTGATTCACTTTGCTGCTCCCA
AGGGTGCGTGACCTTTTGCTTCCGATTCCTTCAGACTTTGGAATTGTTTCCCTTCTTGTGCGGATCGTCGCATCT
CACGCAACGTCAGTTCACGCGGCCGTCCCCGCCAACACGTTTGCCATCTACGGGAATGGTGAGGATAAGGAGCTT
ACGGAGCTCGTTCCTGGCATTCTGAATCAGCTTGGCCGTGACTCGCTCGCTTCGCTGCGCAAGCTGGCTGAGAGC
TATCAGAACATGCAAAAGGGCGAAAAGGGCGAAGATGACGACGACGAGATTCCAGATCTGGTTGAGGGTGAGAAC
TTTGAGAGCAAGGTCGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail