Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|609
Gene name
LocationContig_119:31091..31888
Strand+
Gene length (bp)797
Transcript length (bp)687
Coding sequence length (bp)687
Protein length (aa) 229

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01878 EVE EVE domain 2.9E-45 55 212

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q91YJ3|THYN1_MOUSE Thymocyte nuclear protein 1 OS=Mus musculus GN=Thyn1 PE=1 SV=1 2 213 2.0E-46
sp|Q9P016|THYN1_HUMAN Thymocyte nuclear protein 1 OS=Homo sapiens GN=THYN1 PE=1 SV=1 55 216 8.0E-45
sp|Q6P3E0|THYN1_RAT Thymocyte nuclear protein 1 OS=Rattus norvegicus GN=Thyn1 PE=2 SV=1 2 213 4.0E-44
sp|Q90679|THYN1_CHICK Thymocyte nuclear protein 1 OS=Gallus gallus GN=THYN1 PE=1 SV=1 55 217 2.0E-43
sp|Q6PFL8|THYN1_DANRE Thymocyte nuclear protein 1 OS=Danio rerio GN=thyn1 PE=2 SV=1 14 216 6.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q91YJ3|THYN1_MOUSE Thymocyte nuclear protein 1 OS=Mus musculus GN=Thyn1 PE=1 SV=1 2 213 2.0E-46
sp|Q9P016|THYN1_HUMAN Thymocyte nuclear protein 1 OS=Homo sapiens GN=THYN1 PE=1 SV=1 55 216 8.0E-45
sp|Q6P3E0|THYN1_RAT Thymocyte nuclear protein 1 OS=Rattus norvegicus GN=Thyn1 PE=2 SV=1 2 213 4.0E-44
sp|Q90679|THYN1_CHICK Thymocyte nuclear protein 1 OS=Gallus gallus GN=THYN1 PE=1 SV=1 55 217 2.0E-43
sp|Q6PFL8|THYN1_DANRE Thymocyte nuclear protein 1 OS=Danio rerio GN=thyn1 PE=2 SV=1 14 216 6.0E-43
sp|O94645|YBV3_SCHPO Uncharacterized protein C21.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21.03c PE=4 SV=3 55 228 4.0E-36
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1120
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6125
Ophiocordyceps australis map64 (Brazil) OphauB2|7826
Ophiocordyceps camponoti-floridani Ophcf2|02730
Ophiocordyceps camponoti-rufipedis Ophun1|609 (this protein)
Ophiocordyceps kimflemingae Ophio5|1810
Ophiocordyceps subramaniannii Hirsu2|10163

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|609
MPKRTATSSNPPPKRRRSSRQAAVPQTESKEDETPGSDSVPAVNPEAPRHEGEWYWLMKAEPEPRMERGVDVSFS
IDCLRAKTEPEPWDGIRAYAARNNLRQMKVHDKSFFYHSNCKEPAIVGTMEIVKEYSPDKTALDPEAPYYDAAST
ADNQRWSVVHVEFRRKFAVPIPLRELRQMGKPGGVLEGMQMLRQSRLSVSRVSSAEWEALCRLADERAAEAGLEH
EDR*
Coding >Ophun1|609
ATGCCCAAACGCACCGCAACCTCGTCCAATCCGCCCCCCAAGCGCCGGCGCTCCTCCCGCCAGGCCGCCGTCCCC
CAGACCGAGAGCAAAGAGGATGAGACCCCCGGCTCCGACTCCGTGCCGGCCGTCAACCCCGAGGCCCCGCGGCAC
GAGGGCGAGTGGTACTGGCTGATGAAGGCGGAGCCTGAGCCGAGGATGGAGAGGGGCGTCGATGTCAGCTTTAGC
ATCGATTGTCTGCGGGCTAAGACGGAGCCTGAGCCTTGGGATGGGATCAGGGCATACGCTGCCAGGAATAACCTG
CGGCAGATGAAGGTCCATGACAAGAGCTTCTTCTACCACTCCAACTGCAAAGAACCAGCCATCGTGGGCACAATG
GAAATCGTCAAGGAGTATTCCCCAGACAAAACAGCCCTAGACCCGGAAGCCCCCTACTACGACGCAGCCTCGACG
GCGGATAACCAGCGGTGGAGCGTGGTGCACGTCGAGTTCCGGCGCAAGTTTGCAGTGCCCATCCCCCTGCGCGAG
CTGCGGCAGATGGGCAAGCCAGGCGGCGTGCTCGAGGGGATGCAGATGCTCCGTCAGTCGCGGCTGAGCGTGAGC
AGGGTGTCGTCGGCTGAGTGGGAGGCGTTGTGCAGGCTTGCTGATGAGAGGGCAGCCGAGGCGGGGCTGGAGCAC
GAGGATAGATAG
Transcript >Ophun1|609
ATGCCCAAACGCACCGCAACCTCGTCCAATCCGCCCCCCAAGCGCCGGCGCTCCTCCCGCCAGGCCGCCGTCCCC
CAGACCGAGAGCAAAGAGGATGAGACCCCCGGCTCCGACTCCGTGCCGGCCGTCAACCCCGAGGCCCCGCGGCAC
GAGGGCGAGTGGTACTGGCTGATGAAGGCGGAGCCTGAGCCGAGGATGGAGAGGGGCGTCGATGTCAGCTTTAGC
ATCGATTGTCTGCGGGCTAAGACGGAGCCTGAGCCTTGGGATGGGATCAGGGCATACGCTGCCAGGAATAACCTG
CGGCAGATGAAGGTCCATGACAAGAGCTTCTTCTACCACTCCAACTGCAAAGAACCAGCCATCGTGGGCACAATG
GAAATCGTCAAGGAGTATTCCCCAGACAAAACAGCCCTAGACCCGGAAGCCCCCTACTACGACGCAGCCTCGACG
GCGGATAACCAGCGGTGGAGCGTGGTGCACGTCGAGTTCCGGCGCAAGTTTGCAGTGCCCATCCCCCTGCGCGAG
CTGCGGCAGATGGGCAAGCCAGGCGGCGTGCTCGAGGGGATGCAGATGCTCCGTCAGTCGCGGCTGAGCGTGAGC
AGGGTGTCGTCGGCTGAGTGGGAGGCGTTGTGCAGGCTTGCTGATGAGAGGGCAGCCGAGGCGGGGCTGGAGCAC
GAGGATAGATAG
Gene >Ophun1|609
ATGCCCAAACGCACCGCAACCTCGTCCAATCCGCCCCCCAAGCGCCGGCGCTCCTCCCGCCAGGCCGCCGTCCCC
CAGACCGAGAGCAAAGAGGATGAGACCCCCGGCTCCGACTCCGTGCCGGCCGTCAACCCCGAGGCCCCGCGGCAC
GAGGGCGAGTGGTACTGGCTGATGAAGGCGGAGCCTGAGCCGAGGATGGAGAGGGGCGTCGATGTCAGCTTTAGC
ATCGATTGTCTGCGGGCTAAGACGGAGCCTGAGCCTTGGGATGGTGAGGGTTGCTTTCTTCATGATTGGGGCTTT
GATGCTGATGCTGTCGACTAGGGATCAGGGCATACGCTGCCAGGAATAACCTGCGGCAGATGAAGGTCCATGACA
AGAGCTTCTTCTACCACTCCAACTGCAAAGAACCAGCCATCGTGGGCACAATGGAAATCGTCAAGGAGTATTCCC
CAGACAGTAAGACGACCTCGGCCAGCTACCCACACTCCCACCAGCTAACAACAAGACACGCAGAAACAGCCCTAG
ACCCGGAAGCCCCCTACTACGACGCAGCCTCGACGGCGGATAACCAGCGGTGGAGCGTGGTGCACGTCGAGTTCC
GGCGCAAGTTTGCAGTGCCCATCCCCCTGCGCGAGCTGCGGCAGATGGGCAAGCCAGGCGGCGTGCTCGAGGGGA
TGCAGATGCTCCGTCAGTCGCGGCTGAGCGTGAGCAGGGTGTCGTCGGCTGAGTGGGAGGCGTTGTGCAGGCTTG
CTGATGAGAGGGCAGCCGAGGCGGGGCTGGAGCACGAGGATAGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail