Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6087
Gene name
LocationContig_64:30623..33825
Strand+
Gene length (bp)3202
Transcript length (bp)3069
Coding sequence length (bp)3069
Protein length (aa) 1023

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 1.7E-45 168 489
PF16004 EFTUD2 116 kDa U5 small nuclear ribonucleoprotein component N-terminus 9.4E-31 26 150
PF03764 EFG_IV Elongation factor G, domain IV 9.3E-23 759 875
PF00679 EFG_C Elongation factor G C-terminus 1.1E-17 878 965
PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2 7.3E-08 541 615
PF14492 EFG_III Elongation Factor G, domain III 6.1E-07 635 700
PF01926 MMR_HSR1 50S ribosome-binding GTPase 8.2E-05 171 306

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5F3X4|U5S1_CHICK 116 kDa U5 small nuclear ribonucleoprotein component OS=Gallus gallus GN=EFTUD2 PE=2 SV=1 97 1006 0.0E+00
sp|Q15029|U5S1_HUMAN 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens GN=EFTUD2 PE=1 SV=1 97 1006 0.0E+00
sp|O08810|U5S1_MOUSE 116 kDa U5 small nuclear ribonucleoprotein component OS=Mus musculus GN=Eftud2 PE=1 SV=1 97 1006 0.0E+00
sp|Q5R6E0|U5S1_PONAB 116 kDa U5 small nuclear ribonucleoprotein component OS=Pongo abelii GN=EFTUD2 PE=2 SV=1 97 1006 0.0E+00
sp|A4FUD3|U5S1_BOVIN 116 kDa U5 small nuclear ribonucleoprotein component OS=Bos taurus GN=EFTUD2 PE=2 SV=1 97 1006 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5F3X4|U5S1_CHICK 116 kDa U5 small nuclear ribonucleoprotein component OS=Gallus gallus GN=EFTUD2 PE=2 SV=1 97 1006 0.0E+00
sp|Q15029|U5S1_HUMAN 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens GN=EFTUD2 PE=1 SV=1 97 1006 0.0E+00
sp|O08810|U5S1_MOUSE 116 kDa U5 small nuclear ribonucleoprotein component OS=Mus musculus GN=Eftud2 PE=1 SV=1 97 1006 0.0E+00
sp|Q5R6E0|U5S1_PONAB 116 kDa U5 small nuclear ribonucleoprotein component OS=Pongo abelii GN=EFTUD2 PE=2 SV=1 97 1006 0.0E+00
sp|A4FUD3|U5S1_BOVIN 116 kDa U5 small nuclear ribonucleoprotein component OS=Bos taurus GN=EFTUD2 PE=2 SV=1 97 1006 0.0E+00
sp|O94316|SN114_SCHPO Pre-mRNA-splicing factor cwf10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf10 PE=1 SV=2 95 1019 0.0E+00
sp|Q90705|EF2_CHICK Elongation factor 2 OS=Gallus gallus GN=EEF2 PE=1 SV=3 152 1006 0.0E+00
sp|A0SXL6|EF2_CALJA Elongation factor 2 OS=Callithrix jacchus GN=EEF2 PE=2 SV=1 152 1006 0.0E+00
sp|Q3SYU2|EF2_BOVIN Elongation factor 2 OS=Bos taurus GN=EEF2 PE=2 SV=3 152 1006 0.0E+00
sp|Q5R8Z3|EF2_PONAB Elongation factor 2 OS=Pongo abelii GN=EEF2 PE=2 SV=3 152 1006 0.0E+00
sp|P13639|EF2_HUMAN Elongation factor 2 OS=Homo sapiens GN=EEF2 PE=1 SV=4 152 1006 0.0E+00
sp|P05197|EF2_RAT Elongation factor 2 OS=Rattus norvegicus GN=Eef2 PE=1 SV=4 152 1006 0.0E+00
sp|P58252|EF2_MOUSE Elongation factor 2 OS=Mus musculus GN=Eef2 PE=1 SV=2 152 1006 0.0E+00
sp|P09445|EF2_CRIGR Elongation factor 2 OS=Cricetulus griseus GN=EEF2 PE=1 SV=4 152 1006 0.0E+00
sp|Q23716|EF2_CRYPV Elongation factor 2 OS=Cryptosporidium parvum PE=3 SV=1 152 999 0.0E+00
sp|O14460|EF2_SCHPO Elongation factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eft201 PE=1 SV=2 152 1013 0.0E+00
sp|P13060|EF2_DROME Elongation factor 2 OS=Drosophila melanogaster GN=EF2 PE=1 SV=4 152 997 0.0E+00
sp|Q96X45|EF2_NEUCR Elongation factor 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cot-3 PE=3 SV=3 162 999 0.0E+00
sp|P29691|EF2_CAEEL Elongation factor 2 OS=Caenorhabditis elegans GN=eef-2 PE=2 SV=4 162 999 0.0E+00
sp|Q6BJ25|EF2_DEBHA Elongation factor 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EFT1 PE=3 SV=1 152 999 0.0E+00
sp|P15112|EF2_DICDI Elongation factor 2 OS=Dictyostelium discoideum GN=efbA PE=1 SV=2 162 999 0.0E+00
sp|O23755|EF2_BETVU Elongation factor 2 OS=Beta vulgaris PE=2 SV=1 152 1000 0.0E+00
sp|A5DI11|EF2_PICGU Elongation factor 2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=EFT2 PE=3 SV=1 152 999 0.0E+00
sp|P32324|EF2_YEAST Elongation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFT1 PE=1 SV=1 152 999 0.0E+00
sp|Q1HPK6|EF2_BOMMO Translation elongation factor 2 OS=Bombyx mori GN=tef2 PE=1 SV=1 152 997 0.0E+00
sp|Q875Z2|EF2_NAUCC Elongation factor 2 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=EFT1 PE=3 SV=1 152 999 0.0E+00
sp|Q754C8|EF2_ASHGO Elongation factor 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EFT1 PE=3 SV=1 152 999 0.0E+00
sp|Q875S0|EF2_LACK1 Elongation factor 2 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=EFT2 PE=3 SV=1 152 999 0.0E+00
sp|Q5A0M4|EF2_CANAL Elongation factor 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EFT2 PE=1 SV=2 152 965 0.0E+00
sp|C4YJQ8|EF2_CANAW Elongation factor 2 OS=Candida albicans (strain WO-1) GN=EFT2 PE=3 SV=1 152 965 0.0E+00
sp|Q874B9|EF2_PICPA Elongation factor 2 OS=Komagataella pastoris GN=EFT1 PE=3 SV=1 152 999 0.0E+00
sp|P28996|EF2_PARKE Elongation factor 2 OS=Parachlorella kessleri PE=2 SV=1 152 995 0.0E+00
sp|Q6CPQ9|EF2_KLULA Elongation factor 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=EFT1 PE=3 SV=1 152 999 0.0E+00
sp|Q6FYA7|EF2_CANGA Elongation factor 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=EFT1 PE=3 SV=1 152 999 9.0E-180
sp|Q06193|EF2_ENTHI Elongation factor 2 OS=Entamoeba histolytica GN=EF-2 PE=2 SV=1 159 999 3.0E-174
sp|P36048|SN114_YEAST Pre-mRNA-splicing factor SNU114 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNU114 PE=1 SV=1 108 1019 2.0E-169
sp|Q17152|EF2_BLAHO Elongation factor 2 OS=Blastocystis hominis PE=2 SV=1 152 999 2.0E-151
sp|Q8SQT7|EF2_ENCCU Elongation factor 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=EFT1 PE=1 SV=1 154 962 4.0E-104
sp|O74945|RIA1_SCHPO Ribosome assembly protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ria1 PE=3 SV=1 159 995 1.0E-95
sp|Q9HM85|EF2_HALSA Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=fusA PE=3 SV=2 162 995 2.0E-80
sp|B0R8C8|EF2_HALS3 Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=fusA PE=3 SV=1 162 995 2.0E-80
sp|Q5UZS7|EF2_HALMA Elongation factor 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=fusA PE=3 SV=1 162 1000 1.0E-75
sp|Q3IUM4|EF2_NATPD Elongation factor 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=fusA PE=3 SV=1 162 957 2.0E-72
sp|C7NYH7|EF2_HALMD Elongation factor 2 OS=Halomicrobium mukohataei (strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541) GN=fusA PE=3 SV=1 162 995 6.0E-71
sp|B8D6B2|EF2_DESK1 Elongation factor 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=fusA PE=3 SV=1 153 1007 2.0E-70
sp|B1YE08|EF2_PYRNV Elongation factor 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=fusA PE=3 SV=1 472 1006 8.0E-60
sp|A3MSN3|EF2_PYRCJ Elongation factor 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=fusA PE=3 SV=1 474 1006 1.0E-59
sp|A4WMR8|EF2_PYRAR Elongation factor 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=fusA PE=3 SV=1 474 1006 7.0E-59
sp|A1RVX2|EF2_PYRIL Elongation factor 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=fusA PE=3 SV=1 472 1006 8.0E-59
sp|B1L7Q0|EF2_KORCO Elongation factor 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=fusA PE=3 SV=1 478 999 3.0E-58
sp|Q9YC19|EF2_AERPE Elongation factor 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=fusA PE=3 SV=1 478 995 8.0E-58
sp|A8ACA7|EF2_IGNH4 Elongation factor 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=fusA PE=3 SV=1 478 1007 1.0E-57
sp|Q8ZZC1|EF2_PYRAE Elongation factor 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=fusA PE=3 SV=1 472 1006 3.0E-57
sp|O28385|EF2_ARCFU Elongation factor 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=fusA PE=3 SV=1 481 996 1.0E-55
sp|A4YCV9|EF2_METS5 Elongation factor 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=fusA PE=3 SV=1 478 1005 4.0E-54
sp|A3DMV6|EF2_STAMF Elongation factor 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=fusA PE=3 SV=1 472 996 2.0E-53
sp|B8GJK8|EF2_METPE Elongation factor 2 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=fusA PE=3 SV=1 480 999 4.0E-52
sp|Q975H5|EF2_SULTO Elongation factor 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=fusA PE=3 SV=3 478 1005 2.0E-50
sp|P30925|EF2_SULSO Elongation factor 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fusA PE=1 SV=3 478 1005 5.0E-50
sp|C3NED6|EF2_SULIY Elongation factor 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=fusA PE=3 SV=1 478 1005 5.0E-50
sp|C3NHB6|EF2_SULIN Elongation factor 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=fusA PE=3 SV=1 478 1005 5.0E-50
sp|C3MVH1|EF2_SULIM Elongation factor 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=fusA PE=3 SV=1 478 1005 5.0E-50
sp|C3MQ53|EF2_SULIL Elongation factor 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=fusA PE=3 SV=1 478 1005 5.0E-50
sp|C4KHE9|EF2_SULIK Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=fusA PE=3 SV=1 478 1005 5.0E-50
sp|C3N5S0|EF2_SULIA Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.27) GN=fusA PE=3 SV=1 478 1005 5.0E-50
sp|A0B7D5|EF2_METTP Elongation factor 2 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=fusA PE=3 SV=1 477 962 6.0E-50
sp|Q2NEL0|EF2_METST Elongation factor 2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=fusA PE=3 SV=1 483 996 2.0E-49
sp|A5ULM6|EF2_METS3 Elongation factor 2 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=fusA PE=3 SV=1 480 996 3.0E-49
sp|Q7Z2Z2|ETUD1_HUMAN Elongation factor Tu GTP-binding domain-containing protein 1 OS=Homo sapiens GN=EFTUD1 PE=1 SV=2 159 540 4.0E-49
sp|Q58448|EF2_METJA Elongation factor 2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=fusA PE=3 SV=1 481 962 1.0E-48
sp|A3CXM8|EF2_METMJ Elongation factor 2 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=fusA PE=3 SV=1 480 999 1.0E-48
sp|A7I4X4|EF2_METB6 Elongation factor 2 OS=Methanoregula boonei (strain 6A8) GN=fusA PE=3 SV=1 481 999 3.0E-48
sp|P33159|EF2_DESMO Elongation factor 2 OS=Desulfurococcus mobilis GN=fusA PE=3 SV=1 478 1007 1.0E-47
sp|Q8TXJ4|EF2_METKA Elongation factor 2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=fusA PE=3 SV=1 481 960 2.0E-47
sp|Q8C0D5|ETUD1_MOUSE Elongation factor Tu GTP-binding domain-containing protein 1 OS=Mus musculus GN=Eftud1 PE=1 SV=1 159 540 4.0E-47
sp|Q6L200|EF2_PICTO Elongation factor 2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=fusA PE=3 SV=1 478 1013 7.0E-47
sp|A0RW30|EF2_CENSY Elongation factor 2 OS=Cenarchaeum symbiosum (strain A) GN=fusA PE=3 SV=1 483 1008 1.0E-46
sp|Q979T3|EF2_THEVO Elongation factor 2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=fusA PE=3 SV=1 478 968 4.0E-45
sp|Q7Z2Z2|ETUD1_HUMAN Elongation factor Tu GTP-binding domain-containing protein 1 OS=Homo sapiens GN=EFTUD1 PE=1 SV=2 531 995 5.0E-45
sp|P53893|RIA1_YEAST Ribosome assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIA1 PE=1 SV=1 162 533 6.0E-45
sp|A6UV44|EF2_META3 Elongation factor 2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=fusA PE=3 SV=1 480 998 6.0E-45
sp|O27131|EF2_METTH Elongation factor 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=fusA PE=3 SV=2 480 996 8.0E-45
sp|P61878|EF2_PYRWO Elongation factor 2 OS=Pyrococcus woesei GN=fusA PE=3 SV=1 481 962 1.0E-44
sp|P61877|EF2_PYRFU Elongation factor 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=fusA PE=3 SV=1 481 962 1.0E-44
sp|A6VGV5|EF2_METM7 Elongation factor 2 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=fusA PE=3 SV=1 480 998 3.0E-44
sp|P23112|EF2_SULAC Elongation factor 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=fusA PE=1 SV=3 478 994 5.0E-44
sp|A9A9U4|EF2_METM6 Elongation factor 2 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=fusA PE=3 SV=1 480 998 2.0E-43
sp|O59521|EF2_PYRHO Elongation factor 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=fusA PE=1 SV=2 481 962 3.0E-43
sp|Q9V1Z8|EF2_PYRAB Elongation factor 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=fusA PE=3 SV=1 481 962 1.0E-42
sp|Q8TRC3|EF2_METAC Elongation factor 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=fusA PE=3 SV=1 478 999 1.0E-42
sp|A4FWF0|EF2_METM5 Elongation factor 2 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=fusA PE=3 SV=1 481 998 2.0E-42
sp|O93640|EF2_METTE Elongation factor 2 OS=Methanosarcina thermophila GN=fusA PE=3 SV=1 479 960 3.0E-42
sp|P26752|EF2_THEAC Elongation factor 2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=fusA PE=3 SV=2 478 968 4.0E-42
sp|Q8PUR7|EF2_METMA Elongation factor 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=fusA PE=3 SV=1 478 999 6.0E-42
sp|Q5JFZ3|EF2_THEKO Elongation factor 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=fusA PE=3 SV=1 481 962 7.0E-42
sp|P09604|EF2_METVS Elongation factor 2 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=fusA PE=3 SV=2 480 962 8.0E-42
sp|Q464Z3|EF2_METBF Elongation factor 2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=fusA PE=3 SV=1 478 999 1.0E-41
sp|D3E3N9|EF2_METRM Elongation factor 2 OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=fusA PE=3 SV=1 471 996 1.0E-41
sp|P53893|RIA1_YEAST Ribosome assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIA1 PE=1 SV=1 538 995 3.0E-41
sp|Q6LXI2|EF2_METMP Elongation factor 2 OS=Methanococcus maripaludis (strain S2 / LL) GN=fusA PE=3 SV=1 481 998 3.0E-41
sp|Q8C0D5|ETUD1_MOUSE Elongation factor Tu GTP-binding domain-containing protein 1 OS=Mus musculus GN=Eftud1 PE=1 SV=1 535 995 5.0E-41
sp|C5A6N7|EF2_THEGJ Elongation factor 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=fusA PE=3 SV=1 481 962 1.0E-40
sp|C6A4M0|EF2_THESM Elongation factor 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=fusA PE=3 SV=1 481 996 2.0E-40
sp|B6YVG5|EF2_THEON Elongation factor 2 OS=Thermococcus onnurineus (strain NA1) GN=fusA PE=3 SV=1 481 995 3.0E-40
sp|O93637|EF2_METMT Elongation factor 2 OS=Methanococcoides methylutens GN=fusA PE=3 SV=1 482 999 2.0E-39
sp|Q74M52|EF2_NANEQ Elongation factor 2 OS=Nanoarchaeum equitans (strain Kin4-M) GN=fusA PE=3 SV=1 460 1001 2.0E-38
sp|O93632|EF2_METBU Elongation factor 2 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=fusA PE=3 SV=1 482 986 4.0E-38
sp|Q975H5|EF2_SULTO Elongation factor 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=fusA PE=3 SV=3 162 391 6.0E-33
sp|P61878|EF2_PYRWO Elongation factor 2 OS=Pyrococcus woesei GN=fusA PE=3 SV=1 159 381 5.0E-32
sp|P61877|EF2_PYRFU Elongation factor 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=fusA PE=3 SV=1 159 381 5.0E-32
sp|O59521|EF2_PYRHO Elongation factor 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=fusA PE=1 SV=2 159 370 5.0E-32
sp|Q9V1Z8|EF2_PYRAB Elongation factor 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=fusA PE=3 SV=1 159 370 6.0E-32
sp|B6YVG5|EF2_THEON Elongation factor 2 OS=Thermococcus onnurineus (strain NA1) GN=fusA PE=3 SV=1 159 389 8.0E-32
sp|A3DMV6|EF2_STAMF Elongation factor 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=fusA PE=3 SV=1 162 370 1.0E-31
sp|A4YCV9|EF2_METS5 Elongation factor 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=fusA PE=3 SV=1 151 370 3.0E-31
sp|C5A6N7|EF2_THEGJ Elongation factor 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=fusA PE=3 SV=1 159 370 3.0E-31
sp|A8ACA7|EF2_IGNH4 Elongation factor 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=fusA PE=3 SV=1 162 370 4.0E-31
sp|Q5JFZ3|EF2_THEKO Elongation factor 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=fusA PE=3 SV=1 159 389 5.0E-31
sp|P23112|EF2_SULAC Elongation factor 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=fusA PE=1 SV=3 162 391 6.0E-31
sp|Q6L200|EF2_PICTO Elongation factor 2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=fusA PE=3 SV=1 162 377 7.0E-31
sp|Q979T3|EF2_THEVO Elongation factor 2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=fusA PE=3 SV=1 162 375 1.0E-30
sp|Q3A9R2|EFG_CARHZ Elongation factor G OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=fusA PE=3 SV=1 167 971 1.0E-30
sp|O28385|EF2_ARCFU Elongation factor 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=fusA PE=3 SV=1 159 392 2.0E-30
sp|P30925|EF2_SULSO Elongation factor 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fusA PE=1 SV=3 162 370 3.0E-30
sp|Q9YC19|EF2_AERPE Elongation factor 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=fusA PE=3 SV=1 162 393 4.0E-30
sp|C3NED6|EF2_SULIY Elongation factor 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=fusA PE=3 SV=1 162 370 4.0E-30
sp|C3NHB6|EF2_SULIN Elongation factor 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=fusA PE=3 SV=1 162 370 4.0E-30
sp|C3MVH1|EF2_SULIM Elongation factor 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=fusA PE=3 SV=1 162 370 4.0E-30
sp|C3MQ53|EF2_SULIL Elongation factor 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=fusA PE=3 SV=1 162 370 4.0E-30
sp|C4KHE9|EF2_SULIK Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=fusA PE=3 SV=1 162 370 4.0E-30
sp|C3N5S0|EF2_SULIA Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.27) GN=fusA PE=3 SV=1 162 370 4.0E-30
sp|P26752|EF2_THEAC Elongation factor 2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=fusA PE=3 SV=2 162 375 4.0E-30
sp|Q74M52|EF2_NANEQ Elongation factor 2 OS=Nanoarchaeum equitans (strain Kin4-M) GN=fusA PE=3 SV=1 162 394 4.0E-30
sp|B1L7Q0|EF2_KORCO Elongation factor 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=fusA PE=3 SV=1 159 369 6.0E-30
sp|C6A4M0|EF2_THESM Elongation factor 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=fusA PE=3 SV=1 159 389 2.0E-29
sp|A5ULM6|EF2_METS3 Elongation factor 2 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=fusA PE=3 SV=1 159 370 3.0E-29
sp|O27131|EF2_METTH Elongation factor 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=fusA PE=3 SV=2 159 391 4.0E-29
sp|O93632|EF2_METBU Elongation factor 2 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=fusA PE=3 SV=1 159 370 6.0E-29
sp|A5EX85|EFG_DICNV Elongation factor G OS=Dichelobacter nodosus (strain VCS1703A) GN=fusA PE=3 SV=1 170 965 1.0E-28
sp|A6UV44|EF2_META3 Elongation factor 2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=fusA PE=3 SV=1 159 370 2.0E-27
sp|O93637|EF2_METMT Elongation factor 2 OS=Methanococcoides methylutens GN=fusA PE=3 SV=1 159 370 2.0E-27
sp|Q58448|EF2_METJA Elongation factor 2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=fusA PE=3 SV=1 159 370 5.0E-27
sp|A7I4X4|EF2_METB6 Elongation factor 2 OS=Methanoregula boonei (strain 6A8) GN=fusA PE=3 SV=1 159 399 6.0E-27
sp|Q6LXI2|EF2_METMP Elongation factor 2 OS=Methanococcus maripaludis (strain S2 / LL) GN=fusA PE=3 SV=1 162 370 8.0E-27
sp|A4WMR8|EF2_PYRAR Elongation factor 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=fusA PE=3 SV=1 166 370 9.0E-27
sp|Q8TXJ4|EF2_METKA Elongation factor 2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=fusA PE=3 SV=1 167 370 1.0E-26
sp|A4FWF0|EF2_METM5 Elongation factor 2 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=fusA PE=3 SV=1 162 370 2.0E-26
sp|A9A9U4|EF2_METM6 Elongation factor 2 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=fusA PE=3 SV=1 162 370 3.0E-26
sp|A6VGV5|EF2_METM7 Elongation factor 2 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=fusA PE=3 SV=1 162 370 4.0E-26
sp|P09604|EF2_METVS Elongation factor 2 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=fusA PE=3 SV=2 162 370 4.0E-26
sp|P33159|EF2_DESMO Elongation factor 2 OS=Desulfurococcus mobilis GN=fusA PE=3 SV=1 153 375 5.0E-26
sp|A3MSN3|EF2_PYRCJ Elongation factor 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=fusA PE=3 SV=1 166 370 7.0E-26
sp|O93640|EF2_METTE Elongation factor 2 OS=Methanosarcina thermophila GN=fusA PE=3 SV=1 159 370 8.0E-26
sp|B1YE08|EF2_PYRNV Elongation factor 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=fusA PE=3 SV=1 166 370 9.0E-26
sp|A1RVX2|EF2_PYRIL Elongation factor 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=fusA PE=3 SV=1 166 370 9.0E-26
sp|Q8ZZC1|EF2_PYRAE Elongation factor 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=fusA PE=3 SV=1 166 370 9.0E-26
sp|Q464Z3|EF2_METBF Elongation factor 2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=fusA PE=3 SV=1 159 389 3.0E-25
sp|A3CXM8|EF2_METMJ Elongation factor 2 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=fusA PE=3 SV=1 159 389 4.0E-25
sp|Q8PUR7|EF2_METMA Elongation factor 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=fusA PE=3 SV=1 159 389 1.0E-24
sp|Q8TRC3|EF2_METAC Elongation factor 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=fusA PE=3 SV=1 159 389 3.0E-24
sp|D3E3N9|EF2_METRM Elongation factor 2 OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=fusA PE=3 SV=1 159 370 3.0E-24
sp|Q2NEL0|EF2_METST Elongation factor 2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=fusA PE=3 SV=1 159 370 1.0E-23
sp|A0B7D5|EF2_METTP Elongation factor 2 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=fusA PE=3 SV=1 162 370 5.0E-23
sp|B8GJK8|EF2_METPE Elongation factor 2 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=fusA PE=3 SV=1 159 389 9.0E-23
sp|Q7VTD5|EFG_BORPE Elongation factor G OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=fusA PE=3 SV=1 167 718 9.0E-23
sp|Q7WRC7|EFG1_BORBR Elongation factor G 1 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=fusA1 PE=3 SV=1 167 718 1.0E-22
sp|P18667|EFG_SYNP6 Elongation factor G OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=fusA PE=3 SV=1 167 718 5.0E-22
sp|Q31PV4|EFG_SYNE7 Elongation factor G OS=Synechococcus elongatus (strain PCC 7942) GN=fusA PE=3 SV=1 167 718 5.0E-22
sp|Q7W2F8|EFG1_BORPA Elongation factor G 1 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=fusA1 PE=3 SV=1 167 718 6.0E-22
sp|A0RW30|EF2_CENSY Elongation factor 2 OS=Cenarchaeum symbiosum (strain A) GN=fusA PE=3 SV=1 153 370 8.0E-22
sp|Q16BA3|LEPA_ROSDO Elongation factor 4 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=lepA PE=3 SV=1 170 375 3.0E-21
sp|A8LR11|LEPA_DINSH Elongation factor 4 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=lepA PE=3 SV=1 170 360 1.0E-20
sp|Q820H8|LEPA_NITEU Elongation factor 4 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=lepA PE=3 SV=1 167 358 1.0E-20
sp|Q5LUS0|LEPA_RUEPO Elongation factor 4 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=lepA PE=3 SV=1 159 349 2.0E-20
sp|Q9X1V8|LEPA_THEMA Elongation factor 4 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=lepA PE=3 SV=1 166 308 2.0E-20
sp|B4UDQ7|LEPA_ANASK Elongation factor 4 OS=Anaeromyxobacter sp. (strain K) GN=lepA PE=3 SV=1 170 358 5.0E-20
sp|Q2IIA6|LEPA_ANADE Elongation factor 4 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lepA PE=3 SV=1 170 358 5.0E-20
sp|B8JAF3|LEPA_ANAD2 Elongation factor 4 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=lepA PE=3 SV=1 170 358 6.0E-20
sp|Q1D6M1|LEPA_MYXXD Elongation factor 4 OS=Myxococcus xanthus (strain DK 1622) GN=lepA PE=3 SV=1 170 308 9.0E-20
sp|Q87C09|LEPA_XYLFT Elongation factor 4 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=lepA PE=3 SV=1 170 360 4.0E-19
sp|B2I601|LEPA_XYLF2 Elongation factor 4 OS=Xylella fastidiosa (strain M23) GN=lepA PE=3 SV=1 170 360 4.0E-19
sp|Q0AF67|LEPA_NITEC Elongation factor 4 OS=Nitrosomonas eutropha (strain C91) GN=lepA PE=3 SV=1 167 358 4.0E-19
sp|Q2W0F9|LEPA_MAGSA Elongation factor 4 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=lepA PE=3 SV=1 170 367 5.0E-19
sp|D2VRR7|GUF1_NAEGR Translation factor GUF1 homolog, mitochondrial OS=Naegleria gruberi GN=NAEGRDRAFT_71680 PE=3 SV=1 161 320 6.0E-19
sp|Q1GIV5|LEPA_RUEST Elongation factor 4 OS=Ruegeria sp. (strain TM1040) GN=lepA PE=3 SV=1 159 360 6.0E-19
sp|B8DIZ5|LEPA_DESVM Elongation factor 4 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=lepA PE=3 SV=1 167 363 8.0E-19
sp|Q2SSF7|LEPA_MYCCT Elongation factor 4 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=lepA PE=3 SV=1 168 363 9.0E-19
sp|Q39US7|LEPA_GEOMG Elongation factor 4 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=lepA PE=3 SV=2 167 332 9.0E-19
sp|A6TSM4|LEPA_ALKMQ Elongation factor 4 OS=Alkaliphilus metalliredigens (strain QYMF) GN=lepA PE=3 SV=1 168 308 1.0E-18
sp|P60930|LEPA_BDEBA Elongation factor 4 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lepA PE=3 SV=2 166 308 1.0E-18
sp|Q1MQF3|LEPA_LAWIP Elongation factor 4 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=lepA PE=3 SV=1 162 355 1.0E-18
sp|A8G3D2|LEPA_PROM2 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9215) GN=lepA PE=3 SV=1 170 352 1.0E-18
sp|Q6MTR6|LEPA_MYCMS Elongation factor 4 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=lepA PE=3 SV=1 168 345 1.0E-18
sp|Q31CB8|LEPA_PROM9 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9312) GN=lepA PE=3 SV=1 159 345 1.0E-18
sp|Q0A8Z4|LEPA_ALKEH Elongation factor 4 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=lepA PE=3 SV=1 151 360 1.0E-18
sp|A2BV79|LEPA_PROM5 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9515) GN=lepA PE=3 SV=1 159 345 1.0E-18
sp|A3PBD8|LEPA_PROM0 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9301) GN=lepA PE=3 SV=1 170 352 1.0E-18
sp|A2BPP8|LEPA_PROMS Elongation factor 4 OS=Prochlorococcus marinus (strain AS9601) GN=lepA PE=3 SV=1 170 352 1.0E-18
sp|Q2Y873|LEPA_NITMU Elongation factor 4 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=lepA PE=3 SV=1 167 360 1.0E-18
sp|Q98DV1|LEPA_RHILO Elongation factor 4 OS=Rhizobium loti (strain MAFF303099) GN=lepA PE=3 SV=1 167 360 1.0E-18
sp|C6DZ67|LEPA_GEOSM Elongation factor 4 OS=Geobacter sp. (strain M21) GN=lepA PE=3 SV=1 167 345 1.0E-18
sp|Q7V2Q1|LEPA_PROMP Elongation factor 4 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=lepA PE=3 SV=1 159 345 1.0E-18
sp|B0U3D5|LEPA_XYLFM Elongation factor 4 OS=Xylella fastidiosa (strain M12) GN=lepA PE=3 SV=1 170 360 2.0E-18
sp|B5EB36|LEPA_GEOBB Elongation factor 4 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=lepA PE=3 SV=1 167 345 2.0E-18
sp|Q9PBA1|LEPA_XYLFA Elongation factor 4 OS=Xylella fastidiosa (strain 9a5c) GN=lepA PE=3 SV=1 170 360 2.0E-18
sp|A9KF98|LEPA_COXBN Elongation factor 4 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=lepA PE=3 SV=1 170 448 2.0E-18
sp|Q5WVI1|LEPA_LEGPL Elongation factor 4 OS=Legionella pneumophila (strain Lens) GN=lepA PE=3 SV=1 170 360 2.0E-18
sp|C1F2I3|LEPA_ACIC5 Elongation factor 4 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=lepA PE=3 SV=1 170 356 2.0E-18
sp|A2CBG9|LEPA_PROM3 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9303) GN=lepA PE=3 SV=1 170 363 2.0E-18
sp|B3Q991|LEPA_RHOPT Elongation factor 4 OS=Rhodopseudomonas palustris (strain TIE-1) GN=lepA PE=3 SV=1 167 360 2.0E-18
sp|P60793|LEPA_RHOPA Elongation factor 4 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lepA PE=3 SV=1 167 360 2.0E-18
sp|Q7U5L9|LEPA_SYNPX Elongation factor 4 OS=Synechococcus sp. (strain WH8102) GN=lepA PE=3 SV=1 170 363 2.0E-18
sp|Q2J2Y0|LEPA_RHOP2 Elongation factor 4 OS=Rhodopseudomonas palustris (strain HaA2) GN=lepA PE=3 SV=2 167 308 3.0E-18
sp|Q13E78|LEPA_RHOPS Elongation factor 4 OS=Rhodopseudomonas palustris (strain BisB5) GN=lepA PE=3 SV=2 167 308 3.0E-18
sp|Q6F0Z2|LEPA_MESFL Elongation factor 4 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=lepA PE=3 SV=1 168 363 3.0E-18
sp|Q8DTF3|LEPA_STRMU Elongation factor 4 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=lepA PE=3 SV=1 162 308 3.0E-18
sp|Q1J6V6|LEPA_STRPF Elongation factor 4 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=lepA PE=3 SV=1 161 332 3.0E-18
sp|B3QPU3|LEPA_CHLP8 Elongation factor 4 OS=Chlorobaculum parvum (strain NCIB 8327) GN=lepA PE=3 SV=1 170 330 3.0E-18
sp|A5G4G3|LEPA_GEOUR Elongation factor 4 OS=Geobacter uraniireducens (strain Rf4) GN=lepA PE=3 SV=1 167 332 3.0E-18
sp|Q057R2|LEPA_BUCCC Elongation factor 4 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=lepA PE=3 SV=1 167 308 4.0E-18
sp|Q6MEF3|LEPA_PARUW Elongation factor 4 OS=Protochlamydia amoebophila (strain UWE25) GN=lepA PE=3 SV=1 170 347 4.0E-18
sp|A4WX88|LEPA_RHOS5 Elongation factor 4 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=lepA PE=3 SV=1 170 308 4.0E-18
sp|B5ZXQ5|LEPA_RHILW Elongation factor 4 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=lepA PE=3 SV=1 170 363 4.0E-18
sp|Q7V8S4|LEPA_PROMM Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9313) GN=lepA PE=3 SV=1 170 363 4.0E-18
sp|Q5SKA7|LEPA_THET8 Elongation factor 4 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=lepA PE=1 SV=1 170 356 4.0E-18
sp|A4J080|LEPA_FRATW Elongation factor 4 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=lepA PE=3 SV=1 170 358 4.0E-18
sp|Q0BP65|LEPA_FRATO Elongation factor 4 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=lepA PE=3 SV=1 170 358 4.0E-18
sp|Q2A5X6|LEPA_FRATH Elongation factor 4 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=lepA PE=3 SV=1 170 358 4.0E-18
sp|A7N9A4|LEPA_FRATF Elongation factor 4 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=lepA PE=3 SV=1 170 358 4.0E-18
sp|A8MFA6|LEPA_ALKOO Elongation factor 4 OS=Alkaliphilus oremlandii (strain OhILAs) GN=lepA PE=3 SV=1 167 308 4.0E-18
sp|Q1JH37|LEPA_STRPD Elongation factor 4 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=lepA PE=3 SV=1 161 332 4.0E-18
sp|B5XLC6|LEPA_STRPZ Elongation factor 4 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=lepA PE=3 SV=1 161 332 4.0E-18
sp|B2SEJ6|LEPA_FRATM Elongation factor 4 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=lepA PE=3 SV=1 170 358 4.0E-18
sp|Q5NEF8|LEPA_FRATT Elongation factor 4 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=lepA PE=3 SV=1 170 358 4.0E-18
sp|Q14FW1|LEPA_FRAT1 Elongation factor 4 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=lepA PE=3 SV=1 170 358 4.0E-18
sp|Q48TU0|LEPA_STRPM Elongation factor 4 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=lepA PE=3 SV=1 161 332 4.0E-18
sp|Q1JLY8|LEPA_STRPC Elongation factor 4 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=lepA PE=3 SV=1 161 332 4.0E-18
sp|B9DSE0|LEPA_STRU0 Elongation factor 4 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=lepA PE=3 SV=1 161 308 4.0E-18
sp|B0RX30|LEPA_XANCB Elongation factor 4 OS=Xanthomonas campestris pv. campestris (strain B100) GN=lepA PE=3 SV=1 170 360 4.0E-18
sp|Q4USF4|LEPA_XANC8 Elongation factor 4 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=lepA PE=3 SV=1 170 360 4.0E-18
sp|Q5XCD2|LEPA_STRP6 Elongation factor 4 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=lepA PE=3 SV=1 161 332 4.0E-18
sp|A7TPD4|GUF1_VANPO Translation factor GUF1, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=GUF1 PE=3 SV=1 164 314 4.0E-18
sp|B8I3E6|LEPA_CLOCE Elongation factor 4 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=lepA PE=3 SV=1 170 367 5.0E-18
sp|Q07TF1|LEPA_RHOP5 Elongation factor 4 OS=Rhodopseudomonas palustris (strain BisA53) GN=lepA PE=3 SV=1 167 308 5.0E-18
sp|Q8UIQ2|LEPA_AGRFC Elongation factor 4 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=lepA PE=3 SV=1 167 363 5.0E-18
sp|O25225|TYPA_HELPY GTP-binding protein TypA/BipA homolog OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=typA PE=3 SV=1 170 309 5.0E-18
sp|Q99ZV8|LEPA_STRP1 Elongation factor 4 OS=Streptococcus pyogenes serotype M1 GN=lepA PE=3 SV=1 161 332 5.0E-18
sp|Q1JC06|LEPA_STRPB Elongation factor 4 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=lepA PE=3 SV=1 161 332 5.0E-18
sp|Q8PB55|LEPA_XANCP Elongation factor 4 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lepA PE=3 SV=1 170 360 5.0E-18
sp|Q83BK3|LEPA_COXBU Elongation factor 4 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=lepA PE=3 SV=2 170 448 5.0E-18
sp|A9N944|LEPA_COXBR Elongation factor 4 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=lepA PE=3 SV=1 170 448 5.0E-18
sp|B3PYC6|LEPA_RHIE6 Elongation factor 4 OS=Rhizobium etli (strain CIAT 652) GN=lepA PE=3 SV=1 170 360 5.0E-18
sp|A4VUL8|LEPA_STRSY Elongation factor 4 OS=Streptococcus suis (strain 05ZYH33) GN=lepA PE=3 SV=1 159 308 5.0E-18
sp|A4W0W0|LEPA_STRS2 Elongation factor 4 OS=Streptococcus suis (strain 98HAH33) GN=lepA PE=3 SV=1 159 308 5.0E-18
sp|Q46GZ6|LEPA_PROMT Elongation factor 4 OS=Prochlorococcus marinus (strain NATL2A) GN=lepA PE=3 SV=1 162 354 6.0E-18
sp|Q0ICF2|LEPA_SYNS3 Elongation factor 4 OS=Synechococcus sp. (strain CC9311) GN=lepA PE=3 SV=1 167 341 6.0E-18
sp|A2C0M8|LEPA_PROM1 Elongation factor 4 OS=Prochlorococcus marinus (strain NATL1A) GN=lepA PE=3 SV=1 162 354 6.0E-18
sp|Q92SU3|LEPA_RHIME Elongation factor 4 OS=Rhizobium meliloti (strain 1021) GN=lepA PE=3 SV=1 170 360 6.0E-18
sp|Q9CGI8|LEPA_LACLA Elongation factor 4 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lepA PE=3 SV=1 167 308 6.0E-18
sp|Q31R08|LEPA_SYNE7 Elongation factor 4 OS=Synechococcus elongatus (strain PCC 7942) GN=lepA PE=3 SV=1 170 364 6.0E-18
sp|B8ENL1|LEPA_METSB Elongation factor 4 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=lepA PE=3 SV=1 170 308 6.0E-18
sp|A0L631|LEPA_MAGMM Elongation factor 4 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=lepA PE=3 SV=1 167 357 6.0E-18
sp|B0S1G2|LEPA_FINM2 Elongation factor 4 OS=Finegoldia magna (strain ATCC 29328) GN=lepA PE=3 SV=1 169 358 7.0E-18
sp|A2RL76|LEPA_LACLM Elongation factor 4 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lepA PE=3 SV=1 167 308 7.0E-18
sp|Q88VN0|LEPA1_LACPL Elongation factor 4 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lepA1 PE=3 SV=1 167 308 7.0E-18
sp|Q1MMQ8|LEPA_RHIL3 Elongation factor 4 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=lepA PE=3 SV=1 170 360 7.0E-18
sp|Q2KDL5|LEPA_RHIEC Elongation factor 4 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=lepA PE=3 SV=1 170 360 7.0E-18
sp|P60789|LEPA_GEOSL Elongation factor 4 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=lepA PE=3 SV=1 170 345 7.0E-18
sp|Q02Z80|LEPA_LACLS Elongation factor 4 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=lepA PE=3 SV=1 167 308 7.0E-18
sp|B9KNH9|LEPA_RHOSK Elongation factor 4 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=lepA PE=3 SV=1 170 308 8.0E-18
sp|Q5ZUD2|LEPA_LEGPH Elongation factor 4 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lepA PE=3 SV=1 170 360 8.0E-18
sp|A5ID24|LEPA_LEGPC Elongation factor 4 OS=Legionella pneumophila (strain Corby) GN=lepA PE=3 SV=1 170 360 8.0E-18
sp|Q5X443|LEPA_LEGPA Elongation factor 4 OS=Legionella pneumophila (strain Paris) GN=lepA PE=3 SV=1 170 360 8.0E-18
sp|Q72E76|LEPA_DESVH Elongation factor 4 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=lepA PE=3 SV=1 167 363 8.0E-18
sp|D0NKK0|GUF1_PHYIT Translation factor GUF1 homolog, mitochondrial OS=Phytophthora infestans (strain T30-4) GN=PITG_12454 PE=3 SV=1 166 308 8.0E-18
sp|Q0ATE3|LEPA_MARMM Elongation factor 4 OS=Maricaulis maris (strain MCS10) GN=lepA PE=3 SV=2 166 360 8.0E-18
sp|A3PHQ9|LEPA_RHOS1 Elongation factor 4 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=lepA PE=3 SV=1 170 308 8.0E-18
sp|Q4DZ91|GUF12_TRYCC Translation factor GUF1 homolog 2, mitochondrial OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053504105.210 PE=3 SV=1 141 311 8.0E-18
sp|Q72KV2|LEPA_THET2 Elongation factor 4 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=lepA PE=3 SV=1 170 356 9.0E-18
sp|Q7VDF7|LEPA_PROMA Elongation factor 4 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=lepA PE=3 SV=1 170 354 9.0E-18
sp|Q3J4P0|LEPA_RHOS4 Elongation factor 4 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=lepA PE=3 SV=2 170 308 9.0E-18
sp|A0Q453|LEPA_FRATN Elongation factor 4 OS=Francisella tularensis subsp. novicida (strain U112) GN=lepA PE=3 SV=1 170 358 1.0E-17
sp|Q2JQ51|LEPA_SYNJB Elongation factor 4 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=lepA PE=3 SV=1 170 360 1.0E-17
sp|A9BE39|LEPA_PROM4 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9211) GN=lepA PE=3 SV=1 162 345 1.0E-17
sp|Q7S0P6|GUF1_NEUCR Translation factor guf1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=guf1 PE=3 SV=2 167 358 1.0E-17
sp|A5GRE6|LEPA_SYNR3 Elongation factor 4 OS=Synechococcus sp. (strain RCC307) GN=lepA PE=3 SV=1 170 354 1.0E-17
sp|B6JJT7|LEPA_OLICO Elongation factor 4 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=lepA PE=3 SV=1 170 308 1.0E-17
sp|B2U978|LEPA_RALPJ Elongation factor 4 OS=Ralstonia pickettii (strain 12J) GN=lepA PE=3 SV=1 170 360 1.0E-17
sp|C4Z9E3|LEPA_EUBR3 Elongation factor 4 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=lepA PE=3 SV=1 168 358 1.0E-17
sp|Q6G550|LEPA_BARHE Elongation factor 4 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=lepA PE=3 SV=1 170 360 1.0E-17
sp|Q8YDB8|LEPA_BRUME Elongation factor 4 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=lepA PE=3 SV=1 167 363 1.0E-17
sp|C0RMH8|LEPA_BRUMB Elongation factor 4 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=lepA PE=3 SV=1 167 363 1.0E-17
sp|Q576S5|LEPA_BRUAB Elongation factor 4 OS=Brucella abortus biovar 1 (strain 9-941) GN=lepA PE=3 SV=1 167 363 1.0E-17
sp|Q2YJP8|LEPA_BRUA2 Elongation factor 4 OS=Brucella abortus (strain 2308) GN=lepA PE=3 SV=1 167 363 1.0E-17
sp|B2SC25|LEPA_BRUA1 Elongation factor 4 OS=Brucella abortus (strain S19) GN=lepA PE=3 SV=1 167 363 1.0E-17
sp|C5BRN3|LEPA_TERTT Elongation factor 4 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=lepA PE=3 SV=1 159 308 1.0E-17
sp|Q8FV17|LEPA_BRUSU Elongation factor 4 OS=Brucella suis biovar 1 (strain 1330) GN=lepA PE=3 SV=1 167 363 1.0E-17
sp|A9WW49|LEPA_BRUSI Elongation factor 4 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=lepA PE=3 SV=1 167 363 1.0E-17
sp|A5VVU4|LEPA_BRUO2 Elongation factor 4 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=lepA PE=3 SV=1 167 363 1.0E-17
sp|A9MCW5|LEPA_BRUC2 Elongation factor 4 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=lepA PE=3 SV=1 167 363 1.0E-17
sp|Q9ZLZ3|TYPA_HELPJ GTP-binding protein TypA/BipA homolog OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=typA PE=3 SV=1 170 309 1.0E-17
sp|A7HCF3|LEPA_ANADF Elongation factor 4 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=lepA PE=3 SV=1 170 358 1.0E-17
sp|B4SRL3|LEPA_STRM5 Elongation factor 4 OS=Stenotrophomonas maltophilia (strain R551-3) GN=lepA PE=3 SV=1 170 360 1.0E-17
sp|B3QZT9|LEPA_PHYMT Elongation factor 4 OS=Phytoplasma mali (strain AT) GN=lepA PE=3 SV=1 164 308 1.0E-17
sp|Q9FLE4|GUF1_ARATH Translation factor GUF1 homolog, mitochondrial OS=Arabidopsis thaliana GN=At5g39900 PE=2 SV=1 161 309 1.0E-17
sp|Q21IH3|LEPA_SACD2 Elongation factor 4 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=lepA PE=3 SV=1 159 308 1.0E-17
sp|P65274|LEPA_STRA5 Elongation factor 4 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=lepA PE=3 SV=1 159 308 1.0E-17
sp|P65273|LEPA_STRA3 Elongation factor 4 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=lepA PE=3 SV=1 159 308 1.0E-17
sp|Q3K1F9|LEPA_STRA1 Elongation factor 4 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=lepA PE=3 SV=1 159 308 1.0E-17
sp|B2FQC4|LEPA_STRMK Elongation factor 4 OS=Stenotrophomonas maltophilia (strain K279a) GN=lepA PE=3 SV=1 170 360 1.0E-17
sp|B0KA85|LEPA_THEP3 Elongation factor 4 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=lepA PE=3 SV=1 159 363 1.0E-17
sp|Q8RB72|LEPA_CALS4 Elongation factor 4 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=lepA PE=3 SV=1 159 356 1.0E-17
sp|B0K3Y4|LEPA_THEPX Elongation factor 4 OS=Thermoanaerobacter sp. (strain X514) GN=lepA PE=3 SV=1 159 363 1.0E-17
sp|C1N1Y2|GUFP_MICPC Translation factor GUF1 homolog, chloroplastic OS=Micromonas pusilla (strain CCMP1545) GN=MICPUCDRAFT_51778 PE=3 SV=1 166 308 1.0E-17
sp|Q6F9B9|LEPA_ACIAD Elongation factor 4 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=lepA PE=3 SV=1 170 308 1.0E-17
sp|Q03QU8|LEPA_LACBA Elongation factor 4 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=lepA PE=3 SV=1 162 354 1.0E-17
sp|A8AWG3|LEPA_STRGC Elongation factor 4 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=lepA PE=3 SV=1 159 308 1.0E-17
sp|A4SVW0|LEPA_POLSQ Elongation factor 4 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=lepA PE=3 SV=1 170 308 2.0E-17
sp|A5GMR2|LEPA_SYNPW Elongation factor 4 OS=Synechococcus sp. (strain WH7803) GN=lepA PE=3 SV=1 170 363 2.0E-17
sp|C1CKU6|LEPA_STRZP Elongation factor 4 OS=Streptococcus pneumoniae (strain P1031) GN=lepA PE=3 SV=1 159 308 2.0E-17
sp|Q97QK5|LEPA_STRPN Elongation factor 4 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=lepA PE=3 SV=1 159 308 2.0E-17
sp|Q3ALG5|LEPA_SYNSC Elongation factor 4 OS=Synechococcus sp. (strain CC9605) GN=lepA PE=3 SV=1 170 363 2.0E-17
sp|Q38BU9|GUF1_TRYB2 Translation factor GUF1 homolog, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb10.70.4600 PE=3 SV=1 166 308 2.0E-17
sp|B0VCT7|LEPA_ACIBY Elongation factor 4 OS=Acinetobacter baumannii (strain AYE) GN=lepA PE=3 SV=1 170 308 2.0E-17
sp|A3M7P5|LEPA_ACIBT Elongation factor 4 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=lepA PE=3 SV=2 170 308 2.0E-17
sp|B2HWQ2|LEPA_ACIBC Elongation factor 4 OS=Acinetobacter baumannii (strain ACICU) GN=lepA PE=3 SV=1 170 308 2.0E-17
sp|B7I580|LEPA_ACIB5 Elongation factor 4 OS=Acinetobacter baumannii (strain AB0057) GN=lepA PE=3 SV=1 170 308 2.0E-17
sp|B7GYS7|LEPA_ACIB3 Elongation factor 4 OS=Acinetobacter baumannii (strain AB307-0294) GN=lepA PE=3 SV=1 170 308 2.0E-17
sp|B0VTM2|LEPA_ACIBS Elongation factor 4 OS=Acinetobacter baumannii (strain SDF) GN=lepA PE=3 SV=1 170 308 2.0E-17
sp|Q21BS0|LEPA_RHOPB Elongation factor 4 OS=Rhodopseudomonas palustris (strain BisB18) GN=lepA PE=3 SV=2 170 308 2.0E-17
sp|A6WYK4|LEPA_OCHA4 Elongation factor 4 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=lepA PE=3 SV=1 167 360 2.0E-17
sp|Q6G1F5|LEPA_BARQU Elongation factor 4 OS=Bartonella quintana (strain Toulouse) GN=lepA PE=3 SV=1 170 340 2.0E-17
sp|P0DC23|LEPA_STRPQ Elongation factor 4 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=lepA PE=3 SV=1 161 358 2.0E-17
sp|P0DC22|LEPA_STRP3 Elongation factor 4 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=lepA PE=3 SV=1 161 358 2.0E-17
sp|Q8N442|GUF1_HUMAN Translation factor GUF1, mitochondrial OS=Homo sapiens GN=GUF1 PE=1 SV=1 161 308 2.0E-17
sp|C1C7G9|LEPA_STRP7 Elongation factor 4 OS=Streptococcus pneumoniae (strain 70585) GN=lepA PE=3 SV=1 159 308 2.0E-17
sp|B5E4T8|LEPA_STRP4 Elongation factor 4 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=lepA PE=3 SV=1 159 308 2.0E-17
sp|B5ZAB8|LEPA_HELPG Elongation factor 4 OS=Helicobacter pylori (strain G27) GN=lepA PE=3 SV=1 170 308 2.0E-17
sp|Q03KW7|LEPA_STRTD Elongation factor 4 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=lepA PE=3 SV=1 159 308 2.0E-17
sp|Q5M008|LEPA_STRT1 Elongation factor 4 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=lepA PE=3 SV=1 159 308 2.0E-17
sp|P60794|LEPA_TREDE Elongation factor 4 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=lepA PE=3 SV=1 166 308 2.0E-17
sp|Q5M4M2|LEPA_STRT2 Elongation factor 4 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=lepA PE=3 SV=1 159 308 2.0E-17
sp|C0MDV7|LEPA_STRS7 Elongation factor 4 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=lepA PE=3 SV=1 167 308 2.0E-17
sp|Q182F4|LEPA_PEPD6 Elongation factor 4 OS=Peptoclostridium difficile (strain 630) GN=lepA PE=3 SV=1 164 308 2.0E-17
sp|B2USI5|LEPA_HELPS Elongation factor 4 OS=Helicobacter pylori (strain Shi470) GN=lepA PE=3 SV=1 170 308 2.0E-17
sp|Q0SRD8|LEPA_CLOPS Elongation factor 4 OS=Clostridium perfringens (strain SM101 / Type A) GN=lepA PE=3 SV=1 163 308 2.0E-17
sp|Q8XIS6|LEPA_CLOPE Elongation factor 4 OS=Clostridium perfringens (strain 13 / Type A) GN=lepA PE=3 SV=1 163 308 2.0E-17
sp|Q892Q6|LEPA_CLOTE Elongation factor 4 OS=Clostridium tetani (strain Massachusetts / E88) GN=lepA PE=3 SV=2 167 363 2.0E-17
sp|Q0TNS2|LEPA_CLOP1 Elongation factor 4 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=lepA PE=3 SV=1 163 308 2.0E-17
sp|Q7W455|EFG2_BORPA Elongation factor G 2 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=fusA2 PE=3 SV=1 167 310 3.0E-17
sp|Q3AWX3|LEPA_SYNS9 Elongation factor 4 OS=Synechococcus sp. (strain CC9902) GN=lepA PE=3 SV=1 170 363 3.0E-17
sp|A0Q1R8|LEPA_CLONN Elongation factor 4 OS=Clostridium novyi (strain NT) GN=lepA PE=3 SV=1 167 363 3.0E-17
sp|Q4DKF7|GUF11_TRYCC Translation factor GUF1 homolog 1, mitochondrial OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053503697.90 PE=3 SV=1 141 311 3.0E-17
sp|Q0IFX5|GUF1_AEDAE Translation factor GUF1 homolog, mitochondrial OS=Aedes aegypti GN=AAEL003926 PE=3 SV=1 167 308 3.0E-17
sp|Q5N390|LEPA_SYNP6 Elongation factor 4 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=lepA PE=3 SV=2 170 364 3.0E-17
sp|Q3KMV7|LEPA_CHLTA Elongation factor 4 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=lepA PE=3 SV=1 167 308 3.0E-17
sp|Q4FNH3|LEPA_PELUB Elongation factor 4 OS=Pelagibacter ubique (strain HTCC1062) GN=lepA PE=3 SV=1 163 341 3.0E-17
sp|Q28LR4|LEPA_JANSC Elongation factor 4 OS=Jannaschia sp. (strain CCS1) GN=lepA PE=3 SV=1 159 362 3.0E-17
sp|B0BB51|LEPA_CHLTB Elongation factor 4 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=lepA PE=3 SV=1 167 308 3.0E-17
sp|B0B9H2|LEPA_CHLT2 Elongation factor 4 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=lepA PE=3 SV=1 167 308 3.0E-17
sp|Q97JJ6|LEPA_CLOAB Elongation factor 4 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=lepA PE=3 SV=1 170 308 3.0E-17
sp|C3L3H1|LEPA_CLOB6 Elongation factor 4 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=lepA PE=3 SV=1 170 363 3.0E-17
sp|Q9PKX6|LEPA_CHLMU Elongation factor 4 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=lepA PE=3 SV=1 167 354 3.0E-17
sp|A4IR35|LEPA_GEOTN Elongation factor 4 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=lepA PE=3 SV=1 167 308 3.0E-17
sp|O84067|LEPA_CHLTR Elongation factor 4 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=lepA PE=3 SV=1 167 308 3.0E-17
sp|Q8PMV3|LEPA_XANAC Elongation factor 4 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=lepA PE=3 SV=1 170 360 3.0E-17
sp|A6QLJ3|GUF1_BOVIN Translation factor GUF1, mitochondrial OS=Bos taurus GN=GUF1 PE=2 SV=1 161 308 3.0E-17
sp|B1IC02|LEPA_STRPI Elongation factor 4 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=lepA PE=3 SV=1 159 308 3.0E-17
sp|A4XKA0|LEPA_CALS8 Elongation factor 4 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=lepA PE=3 SV=1 167 308 3.0E-17
sp|A3DF29|LEPA_CLOTH Elongation factor 4 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=lepA PE=3 SV=1 167 308 3.0E-17
sp|Q3BVV9|LEPA_XANC5 Elongation factor 4 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=lepA PE=3 SV=1 170 360 3.0E-17
sp|A8GRF6|LEPA_RICRS Elongation factor 4 OS=Rickettsia rickettsii (strain Sheila Smith) GN=lepA PE=3 SV=1 163 308 3.0E-17
sp|B0BWV5|LEPA_RICRO Elongation factor 4 OS=Rickettsia rickettsii (strain Iowa) GN=lepA PE=3 SV=1 163 308 3.0E-17
sp|A9KKU4|LEPA_CLOPH Elongation factor 4 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=lepA PE=3 SV=1 167 358 3.0E-17
sp|C4K153|LEPA_RICPU Elongation factor 4 OS=Rickettsia peacockii (strain Rustic) GN=lepA PE=3 SV=1 163 308 3.0E-17
sp|Q9I5G8|LEPA_PSEAE Elongation factor 4 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lepA PE=3 SV=1 159 349 3.0E-17
sp|Q02HR9|LEPA_PSEAB Elongation factor 4 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=lepA PE=3 SV=1 159 349 3.0E-17
sp|B7UYX5|LEPA_PSEA8 Elongation factor 4 OS=Pseudomonas aeruginosa (strain LESB58) GN=lepA PE=3 SV=1 159 349 3.0E-17
sp|Q3A445|LEPA_PELCD Elongation factor 4 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lepA PE=3 SV=1 170 308 3.0E-17
sp|Q9ZM93|LEPA_HELPJ Elongation factor 4 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=lepA PE=3 SV=1 170 308 3.0E-17
sp|B4U3G9|LEPA_STREM Elongation factor 4 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=lepA PE=3 SV=1 167 308 4.0E-17
sp|A6VAK9|LEPA_PSEA7 Elongation factor 4 OS=Pseudomonas aeruginosa (strain PA7) GN=lepA PE=3 SV=1 159 349 4.0E-17
sp|Q92IQ1|LEPA_RICCN Elongation factor 4 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=lepA PE=3 SV=1 163 308 4.0E-17
sp|Q2LTN3|LEPA_SYNAS Elongation factor 4 OS=Syntrophus aciditrophicus (strain SB) GN=lepA PE=3 SV=1 167 356 4.0E-17
sp|Q7WFL2|EFG2_BORBR Elongation factor G 2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=fusA2 PE=3 SV=1 167 310 4.0E-17
sp|O87844|EFG2_STRCO Elongation factor G 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=fusB PE=3 SV=1 170 314 4.0E-17
sp|B0G189|GUF1_DICDI Translation factor GUF1 homolog, mitochondrial OS=Dictyostelium discoideum GN=guf1 PE=3 SV=1 167 308 4.0E-17
sp|B3PLG4|LEPA_CELJU Elongation factor 4 OS=Cellvibrio japonicus (strain Ueda107) GN=lepA PE=3 SV=1 159 308 4.0E-17
sp|Q5KWZ3|LEPA_GEOKA Elongation factor 4 OS=Geobacillus kaustophilus (strain HTA426) GN=lepA PE=3 SV=1 167 308 4.0E-17
sp|C0M8H9|LEPA_STRE4 Elongation factor 4 OS=Streptococcus equi subsp. equi (strain 4047) GN=lepA PE=3 SV=1 167 347 4.0E-17
sp|Q3AW54|EFG_SYNS9 Elongation factor G OS=Synechococcus sp. (strain CC9902) GN=fusA PE=3 SV=1 165 309 4.0E-17
sp|B3WEQ5|LEPA_LACCB Elongation factor 4 OS=Lactobacillus casei (strain BL23) GN=lepA PE=3 SV=1 161 308 4.0E-17
sp|Q038N6|LEPA_LACC3 Elongation factor 4 OS=Lactobacillus casei (strain ATCC 334) GN=lepA PE=3 SV=1 161 308 4.0E-17
sp|B1I6E0|LEPA_DESAP Elongation factor 4 OS=Desulforudis audaxviator (strain MP104C) GN=lepA PE=3 SV=1 167 308 4.0E-17
sp|Q0K8N0|LEPA_CUPNH Elongation factor 4 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=lepA PE=3 SV=1 170 360 4.0E-17
sp|Q8RFD1|LEPA_FUSNN Elongation factor 4 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=lepA PE=3 SV=1 170 308 4.0E-17
sp|Q3YSC2|LEPA_EHRCJ Elongation factor 4 OS=Ehrlichia canis (strain Jake) GN=lepA PE=3 SV=1 170 308 4.0E-17
sp|Q46Z15|LEPA_CUPPJ Elongation factor 4 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=lepA PE=3 SV=1 170 360 4.0E-17
sp|C4Z541|LEPA_EUBE2 Elongation factor 4 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=lepA PE=3 SV=1 170 308 4.0E-17
sp|Q8C3X4|GUF1_MOUSE Translation factor Guf1, mitochondrial OS=Mus musculus GN=Guf1 PE=1 SV=1 161 308 4.0E-17
sp|Q38W39|LEPA_LACSS Elongation factor 4 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=lepA PE=3 SV=1 161 308 5.0E-17
sp|Q2G550|LEPA_NOVAD Elongation factor 4 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=lepA PE=3 SV=1 159 356 5.0E-17
sp|B9M4U5|LEPA_GEODF Elongation factor 4 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=lepA PE=3 SV=1 170 308 5.0E-17
sp|Q4FUV9|LEPA_PSYA2 Elongation factor 4 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=lepA PE=3 SV=1 159 349 5.0E-17
sp|Q1QDV6|LEPA_PSYCK Elongation factor 4 OS=Psychrobacter cryohalolentis (strain K5) GN=lepA PE=3 SV=1 159 349 5.0E-17
sp|Q1LKM8|LEPA_CUPMC Elongation factor 4 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=lepA PE=3 SV=1 170 360 5.0E-17
sp|A3QBS5|LEPA_SHELP Elongation factor 4 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=lepA PE=3 SV=1 170 358 5.0E-17
sp|Q8KCH0|LEPA_CHLTE Elongation factor 4 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=lepA PE=3 SV=1 170 330 5.0E-17
sp|A0K5V7|LEPA_BURCH Elongation factor 4 OS=Burkholderia cenocepacia (strain HI2424) GN=lepA PE=3 SV=1 167 358 5.0E-17
sp|B1JYB1|LEPA_BURCC Elongation factor 4 OS=Burkholderia cenocepacia (strain MC0-3) GN=lepA PE=3 SV=1 167 358 5.0E-17
sp|Q1BXU3|LEPA_BURCA Elongation factor 4 OS=Burkholderia cenocepacia (strain AU 1054) GN=lepA PE=3 SV=1 167 358 5.0E-17
sp|Q5H1R5|LEPA_XANOR Elongation factor 4 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=lepA PE=3 SV=1 170 360 5.0E-17
sp|Q2P4M4|LEPA_XANOM Elongation factor 4 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=lepA PE=3 SV=1 170 360 5.0E-17
sp|A5D3X6|LEPA_PELTS Elongation factor 4 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=lepA PE=3 SV=1 167 343 5.0E-17
sp|A4QV78|GUF1_MAGO7 Translation factor GUF1, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=GUF1 PE=3 SV=2 167 363 5.0E-17
sp|Q65VN2|LEPA_MANSM Elongation factor 4 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=lepA PE=3 SV=2 170 358 5.0E-17
sp|B3EE17|LEPA_CHLL2 Elongation factor 4 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=lepA PE=3 SV=1 163 348 6.0E-17
sp|Q0BH06|LEPA_BURCM Elongation factor 4 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=lepA PE=3 SV=1 167 358 6.0E-17
sp|B1YVM2|LEPA_BURA4 Elongation factor 4 OS=Burkholderia ambifaria (strain MC40-6) GN=lepA PE=3 SV=1 167 358 6.0E-17
sp|Q89BJ8|LEPA_BRADU Elongation factor 4 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=lepA PE=3 SV=2 170 360 6.0E-17
sp|Q8Y0I4|LEPA_RALSO Elongation factor 4 OS=Ralstonia solanacearum (strain GMI1000) GN=lepA PE=3 SV=1 170 360 6.0E-17
sp|B2SRY0|LEPA_XANOP Elongation factor 4 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=lepA PE=3 SV=1 170 360 6.0E-17
sp|O07631|TYPA_BACSU GTP-binding protein TypA/BipA homolog OS=Bacillus subtilis (strain 168) GN=typA PE=3 SV=1 163 309 6.0E-17
sp|Q5FHQ1|LEPA_EHRRG Elongation factor 4 OS=Ehrlichia ruminantium (strain Gardel) GN=lepA PE=3 SV=1 170 308 6.0E-17
sp|Q1WUE6|LEPA_LACS1 Elongation factor 4 OS=Lactobacillus salivarius (strain UCC118) GN=lepA PE=3 SV=1 170 308 7.0E-17
sp|Q39I75|LEPA_BURL3 Elongation factor 4 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=lepA PE=3 SV=1 170 358 7.0E-17
sp|B7G816|GUF1_PHATC Translation factor GUF1 homolog, mitochondrial OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_22622 PE=3 SV=1 167 358 7.0E-17
sp|Q318N4|EFG_PROM9 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9312) GN=fusA PE=3 SV=1 164 309 7.0E-17
sp|C3PMX3|LEPA_RICAE Elongation factor 4 OS=Rickettsia africae (strain ESF-5) GN=lepA PE=3 SV=1 163 308 7.0E-17
sp|A8G709|EFG_PROM2 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9215) GN=fusA PE=3 SV=1 164 309 7.0E-17
sp|Q2RKX8|LEPA_MOOTA Elongation factor 4 OS=Moorella thermoacetica (strain ATCC 39073) GN=lepA PE=3 SV=1 170 356 7.0E-17
sp|A5FY07|LEPA_ACICJ Elongation factor 4 OS=Acidiphilium cryptum (strain JF-5) GN=lepA PE=3 SV=1 167 360 7.0E-17
sp|Q5HBH4|LEPA_EHRRW Elongation factor 4 OS=Ehrlichia ruminantium (strain Welgevonden) GN=lepA PE=3 SV=1 170 308 7.0E-17
sp|A2BT84|EFG_PROMS Elongation factor G OS=Prochlorococcus marinus (strain AS9601) GN=fusA PE=3 SV=1 164 309 7.0E-17
sp|B6JKS8|LEPA_HELP2 Elongation factor 4 OS=Helicobacter pylori (strain P12) GN=lepA PE=3 SV=1 170 308 7.0E-17
sp|Q3AF13|LEPA_CARHZ Elongation factor 4 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=lepA PE=3 SV=1 167 308 7.0E-17
sp|Q8CXD0|LEPA_OCEIH Elongation factor 4 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=lepA PE=3 SV=1 162 332 7.0E-17
sp|Q0VP16|LEPA_ALCBS Elongation factor 4 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=lepA PE=3 SV=1 159 358 8.0E-17
sp|Q1WVA0|EFG_LACS1 Elongation factor G OS=Lactobacillus salivarius (strain UCC118) GN=fusA PE=3 SV=1 159 310 8.0E-17
sp|A7IEG8|LEPA_XANP2 Elongation factor 4 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=lepA PE=3 SV=1 170 345 8.0E-17
sp|C6BST2|LEPA_DESAD Elongation factor 4 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=lepA PE=3 SV=1 167 358 8.0E-17
sp|B0CS18|GUF1_LACBS Translation factor GUF1, mitochondrial OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=GUF1 PE=3 SV=1 169 308 8.0E-17
sp|A8FSD4|LEPA_SHESH Elongation factor 4 OS=Shewanella sediminis (strain HAW-EB3) GN=lepA PE=3 SV=1 170 458 8.0E-17
sp|B3E9R0|LEPA_GEOLS Elongation factor 4 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=lepA PE=3 SV=1 168 345 8.0E-17
sp|A4SFN5|LEPA_CHLPM Elongation factor 4 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=lepA PE=3 SV=1 170 308 8.0E-17
sp|Q3SVT1|LEPA_NITWN Elongation factor 4 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=lepA PE=3 SV=1 170 308 8.0E-17
sp|Q0AWL9|LEPA_SYNWW Elongation factor 4 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=lepA PE=3 SV=1 170 308 8.0E-17
sp|Q3AMT5|EFG_SYNSC Elongation factor G OS=Synechococcus sp. (strain CC9605) GN=fusA PE=3 SV=1 164 309 8.0E-17
sp|O25122|LEPA_HELPY Elongation factor 4 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=lepA PE=3 SV=1 170 308 8.0E-17
sp|Q7UZY6|EFG_PROMP Elongation factor G OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=fusA PE=3 SV=1 164 309 8.0E-17
sp|A4JCQ9|LEPA_BURVG Elongation factor 4 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=lepA PE=3 SV=1 167 360 9.0E-17
sp|A0KGF0|LEPA_AERHH Elongation factor 4 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=lepA PE=3 SV=1 170 308 9.0E-17
sp|C1CR98|LEPA_STRZT Elongation factor 4 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=lepA PE=3 SV=1 170 308 9.0E-17
sp|Q8DPN5|LEPA_STRR6 Elongation factor 4 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=lepA PE=3 SV=1 170 308 9.0E-17
sp|B8ZQ69|LEPA_STRPJ Elongation factor 4 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=lepA PE=3 SV=1 170 308 9.0E-17
sp|Q04KB7|LEPA_STRP2 Elongation factor 4 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=lepA PE=3 SV=1 170 308 9.0E-17
sp|P57806|LEPA_PASMU Elongation factor 4 OS=Pasteurella multocida (strain Pm70) GN=lepA PE=3 SV=1 170 358 9.0E-17
sp|C1CEG3|LEPA_STRZJ Elongation factor 4 OS=Streptococcus pneumoniae (strain JJA) GN=lepA PE=3 SV=1 170 308 9.0E-17
sp|B9W892|RRF2M_CANDC Ribosome-releasing factor 2, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=MEF2 PE=3 SV=1 154 309 9.0E-17
sp|Q3B2V1|LEPA_CHLL7 Elongation factor 4 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=lepA PE=3 SV=1 170 308 9.0E-17
sp|Q7U4D2|EFG_SYNPX Elongation factor G OS=Synechococcus sp. (strain WH8102) GN=fusA PE=3 SV=1 164 309 9.0E-17
sp|Q823H7|LEPA_CHLCV Elongation factor 4 OS=Chlamydophila caviae (strain GPIC) GN=lepA PE=3 SV=1 167 308 9.0E-17
sp|Q31HP5|LEPA_THICR Elongation factor 4 OS=Thiomicrospira crunogena (strain XCL-2) GN=lepA PE=3 SV=1 162 308 9.0E-17
sp|Q608M4|LEPA_METCA Elongation factor 4 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=lepA PE=3 SV=1 170 332 9.0E-17
sp|A9VHU6|LEPA_BACWK Elongation factor 4 OS=Bacillus weihenstephanensis (strain KBAB4) GN=lepA PE=3 SV=1 163 358 9.0E-17
sp|Q2NJE6|LEPA_AYWBP Elongation factor 4 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=lepA PE=3 SV=1 170 308 9.0E-17
sp|Q1QR19|LEPA_NITHX Elongation factor 4 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=lepA PE=3 SV=1 170 360 9.0E-17
sp|Q5L659|LEPA_CHLAB Elongation factor 4 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=lepA PE=3 SV=1 167 308 1.0E-16
sp|Q6LMS0|LEPA_PHOPR Elongation factor 4 OS=Photobacterium profundum GN=lepA PE=3 SV=1 167 358 1.0E-16
sp|Q9ZDQ1|LEPA_RICPR Elongation factor 4 OS=Rickettsia prowazekii (strain Madrid E) GN=lepA PE=3 SV=1 163 308 1.0E-16
sp|B3R202|LEPA_CUPTR Elongation factor 4 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=lepA PE=3 SV=1 170 360 1.0E-16
sp|O67618|LEPA_AQUAE Elongation factor 4 OS=Aquifex aeolicus (strain VF5) GN=lepA PE=1 SV=1 167 356 1.0E-16
sp|Q0ID58|EFG_SYNS3 Elongation factor G OS=Synechococcus sp. (strain CC9311) GN=fusA PE=3 SV=1 164 309 1.0E-16
sp|B2G6W5|LEPA_LACRJ Elongation factor 4 OS=Lactobacillus reuteri (strain JCM 1112) GN=lepA PE=3 SV=1 170 332 1.0E-16
sp|A5VJE9|LEPA_LACRD Elongation factor 4 OS=Lactobacillus reuteri (strain DSM 20016) GN=lepA PE=3 SV=1 170 332 1.0E-16
sp|P0A3B4|TYPA_SHIFL GTP-binding protein TypA/BipA OS=Shigella flexneri GN=typA PE=3 SV=1 167 309 1.0E-16
sp|P32132|TYPA_ECOLI GTP-binding protein TypA/BipA OS=Escherichia coli (strain K12) GN=typA PE=1 SV=2 167 309 1.0E-16
sp|P0A3B1|TYPA_ECOL6 GTP-binding protein TypA/BipA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=typA PE=3 SV=1 167 309 1.0E-16
sp|P0A3B3|TYPA_ECO57 GTP-binding protein TypA/BipA OS=Escherichia coli O157:H7 GN=typA PE=3 SV=1 167 309 1.0E-16
sp|P0A3B2|TYPA_ECO27 GTP-binding protein TypA/BipA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=typA PE=3 SV=1 167 309 1.0E-16
sp|A6Q241|LEPA_NITSB Elongation factor 4 OS=Nitratiruptor sp. (strain SB155-2) GN=lepA PE=3 SV=1 167 308 1.0E-16
sp|P43729|LEPA_HAEIN Elongation factor 4 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lepA PE=3 SV=1 170 358 1.0E-16
sp|A9BCK1|EFG_PROM4 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9211) GN=fusA PE=3 SV=1 165 309 1.0E-16
sp|Q1CUF5|LEPA_HELPH Elongation factor 4 OS=Helicobacter pylori (strain HPAG1) GN=lepA PE=3 SV=1 170 308 1.0E-16
sp|A5UFI9|LEPA_HAEIG Elongation factor 4 OS=Haemophilus influenzae (strain PittGG) GN=lepA PE=3 SV=1 170 358 1.0E-16
sp|A5UBC2|LEPA_HAEIE Elongation factor 4 OS=Haemophilus influenzae (strain PittEE) GN=lepA PE=3 SV=1 170 358 1.0E-16
sp|Q4QPM8|LEPA_HAEI8 Elongation factor 4 OS=Haemophilus influenzae (strain 86-028NP) GN=lepA PE=3 SV=1 170 358 1.0E-16
sp|B2JFK0|LEPA_BURP8 Elongation factor 4 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=lepA PE=3 SV=1 167 360 1.0E-16
sp|Q0C5X0|LEPA_HYPNA Elongation factor 4 OS=Hyphomonas neptunium (strain ATCC 15444) GN=lepA PE=3 SV=1 167 363 1.0E-16
sp|B1X3K4|GUFP_PAUCH Translation factor GUF1 homolog, organellar chromatophore OS=Paulinella chromatophora GN=lepA PE=3 SV=1 170 308 1.0E-16
sp|Q65H50|LEPA_BACLD Elongation factor 4 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=lepA PE=3 SV=1 170 308 1.0E-16
sp|Q7VA04|EFG_PROMA Elongation factor G OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=fusA PE=3 SV=1 165 309 1.0E-16
sp|B0C9R9|LEPA_ACAM1 Elongation factor 4 OS=Acaryochloris marina (strain MBIC 11017) GN=lepA PE=3 SV=1 170 308 1.0E-16
sp|Q17X87|LEPA_HELAH Elongation factor 4 OS=Helicobacter acinonychis (strain Sheeba) GN=lepA PE=3 SV=1 170 308 1.0E-16
sp|A5CE57|LEPA_ORITB Elongation factor 4 OS=Orientia tsutsugamushi (strain Boryong) GN=lepA PE=3 SV=1 163 360 1.0E-16
sp|Q88MY7|LEPA_PSEPK Elongation factor 4 OS=Pseudomonas putida (strain KT2440) GN=lepA PE=3 SV=1 159 358 1.0E-16
sp|A9III9|LEPA_BORPD Elongation factor 4 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=lepA PE=3 SV=1 167 308 1.0E-16
sp|A4SRD4|LEPA_AERS4 Elongation factor 4 OS=Aeromonas salmonicida (strain A449) GN=lepA PE=3 SV=1 170 308 1.0E-16
sp|B9MJZ5|LEPA_CALBD Elongation factor 4 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=lepA PE=3 SV=1 167 358 1.0E-16
sp|B8H2Z7|LEPA_CAUCN Elongation factor 4 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=lepA PE=3 SV=1 167 332 1.0E-16
sp|Q1H2L5|LEPA_METFK Elongation factor 4 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=lepA1 PE=3 SV=1 170 358 1.0E-16
sp|Q9A9F4|LEPA_CAUCR Elongation factor 4 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=lepA PE=3 SV=2 167 332 1.0E-16
sp|B3CRQ1|LEPA_ORITI Elongation factor 4 OS=Orientia tsutsugamushi (strain Ikeda) GN=lepA PE=3 SV=1 163 360 1.0E-16
sp|Q2SL35|LEPA_HAHCH Elongation factor 4 OS=Hahella chejuensis (strain KCTC 2396) GN=lepA PE=3 SV=1 170 345 1.0E-16
sp|P72749|TYPA_SYNY3 GTP-binding protein TypA/BipA homolog OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=typA PE=3 SV=1 163 309 1.0E-16
sp|C5Z3W1|GUF1_SORBI Translation factor GUF1 homolog, mitochondrial OS=Sorghum bicolor GN=Sb10g003070 PE=3 SV=1 166 309 1.0E-16
sp|A2C4U6|EFG_PROM1 Elongation factor G OS=Prochlorococcus marinus (strain NATL1A) GN=fusA PE=3 SV=1 165 309 1.0E-16
sp|Q01SV7|LEPA_SOLUE Elongation factor 4 OS=Solibacter usitatus (strain Ellin6076) GN=lepA PE=3 SV=1 167 364 1.0E-16
sp|Q7V501|EFG_PROMM Elongation factor G OS=Prochlorococcus marinus (strain MIT 9313) GN=fusA PE=3 SV=1 165 309 1.0E-16
sp|B2GBR9|LEPA_LACF3 Elongation factor 4 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=lepA PE=3 SV=1 167 332 1.0E-16
sp|Q46IW3|EFG_PROMT Elongation factor G OS=Prochlorococcus marinus (strain NATL2A) GN=fusA PE=3 SV=1 165 309 1.0E-16
sp|C1FVU4|LEPA_CLOBJ Elongation factor 4 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=lepA PE=3 SV=1 170 363 1.0E-16
sp|Q4L6T4|LEPA_STAHJ Elongation factor 4 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=lepA PE=3 SV=1 159 308 1.0E-16
sp|Q254E1|LEPA_CHLFF Elongation factor 4 OS=Chlamydophila felis (strain Fe/C-56) GN=lepA PE=3 SV=1 167 308 2.0E-16
sp|A8FFD6|LEPA_BACP2 Elongation factor 4 OS=Bacillus pumilus (strain SAFR-032) GN=lepA PE=3 SV=1 170 308 2.0E-16
sp|A7MZB0|LEPA_VIBCB Elongation factor 4 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=lepA PE=3 SV=1 170 358 2.0E-16
sp|B7GJ64|EFG_ANOFW Elongation factor G OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=fusA PE=3 SV=1 541 960 2.0E-16
sp|A2CC86|EFG_PROM3 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9303) GN=fusA PE=3 SV=1 165 309 2.0E-16
sp|B1J4D8|LEPA_PSEPW Elongation factor 4 OS=Pseudomonas putida (strain W619) GN=lepA PE=3 SV=1 159 358 2.0E-16
sp|A1SSM6|LEPA_PSYIN Elongation factor 4 OS=Psychromonas ingrahamii (strain 37) GN=lepA PE=3 SV=1 170 404 2.0E-16
sp|Q24SR6|LEPA_DESHY Elongation factor 4 OS=Desulfitobacterium hafniense (strain Y51) GN=lepA PE=3 SV=1 170 308 2.0E-16
sp|B8FUP2|LEPA_DESHD Elongation factor 4 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=lepA PE=3 SV=1 170 308 2.0E-16
sp|Q9RV84|LEPA_DEIRA Elongation factor 4 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=lepA PE=3 SV=1 168 308 2.0E-16
sp|Q87LN7|LEPA_VIBPA Elongation factor 4 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lepA PE=3 SV=1 170 358 2.0E-16
sp|Q3SLQ2|EFG_THIDA Elongation factor G OS=Thiobacillus denitrificans (strain ATCC 25259) GN=fusA PE=3 SV=1 167 309 2.0E-16
sp|A3PEZ8|EFG_PROM0 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9301) GN=fusA PE=3 SV=1 164 309 2.0E-16
sp|A5N6L8|LEPA_CLOK5 Elongation factor 4 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=lepA PE=3 SV=1 170 308 2.0E-16
sp|A8EY28|LEPA_RICCK Elongation factor 4 OS=Rickettsia canadensis (strain McKiel) GN=lepA PE=3 SV=1 163 349 2.0E-16
sp|Q3IDL4|LEPA_PSEHT Elongation factor 4 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=lepA PE=3 SV=1 170 458 2.0E-16
sp|B3WAM2|EFG_LACCB Elongation factor G OS=Lactobacillus casei (strain BL23) GN=fusA PE=3 SV=1 159 310 2.0E-16
sp|Q034X8|EFG_LACC3 Elongation factor G OS=Lactobacillus casei (strain ATCC 334) GN=fusA PE=3 SV=1 159 310 2.0E-16
sp|B1WWD8|LEPA_CYAA5 Elongation factor 4 OS=Cyanothece sp. (strain ATCC 51142) GN=lepA PE=3 SV=1 170 308 2.0E-16
sp|Q8K9C8|TYPA_BUCAP GTP-binding protein TypA/BipA homolog OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=typA PE=3 SV=1 167 309 2.0E-16
sp|Q67S76|LEPA_SYMTH Elongation factor 4 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=lepA PE=3 SV=1 170 345 2.0E-16
sp|A7GZW3|LEPA_CAMC5 Elongation factor 4 OS=Campylobacter curvus (strain 525.92) GN=lepA PE=3 SV=1 170 361 2.0E-16
sp|A7GHI0|LEPA_CLOBL Elongation factor 4 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=lepA PE=3 SV=1 170 308 2.0E-16
sp|B1ILM7|LEPA_CLOBK Elongation factor 4 OS=Clostridium botulinum (strain Okra / Type B1) GN=lepA PE=3 SV=1 170 308 2.0E-16
sp|Q3MG20|LEPA_ANAVT Elongation factor 4 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=lepA PE=3 SV=1 170 308 2.0E-16
sp|Q118Z3|EFG1_TRIEI Elongation factor G 1 OS=Trichodesmium erythraeum (strain IMS101) GN=fusA1 PE=3 SV=1 167 309 2.0E-16
sp|A7MH13|LEPA_CROS8 Elongation factor 4 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=lepA PE=3 SV=1 170 358 2.0E-16
sp|Q5E312|LEPA_VIBF1 Elongation factor 4 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=lepA PE=3 SV=1 170 358 2.0E-16
sp|A9GWZ4|LEPA_SORC5 Elongation factor 4 OS=Sorangium cellulosum (strain So ce56) GN=lepA PE=3 SV=1 170 363 2.0E-16
sp|B7GKC4|LEPA_ANOFW Elongation factor 4 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=lepA PE=3 SV=1 167 358 2.0E-16
sp|B2J5B0|EFG_NOSP7 Elongation factor G OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=fusA PE=3 SV=1 167 309 2.0E-16
sp|A5W8F4|LEPA_PSEP1 Elongation factor 4 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=lepA PE=3 SV=1 170 358 2.0E-16
sp|A5VB59|LEPA_SPHWW Elongation factor 4 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=lepA PE=3 SV=1 163 308 2.0E-16
sp|Q2RNY6|LEPA_RHORT Elongation factor 4 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=lepA PE=3 SV=2 159 345 2.0E-16
sp|Q046C7|EFG_LACGA Elongation factor G OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=fusA PE=3 SV=1 159 310 2.0E-16
sp|B5BAS8|LEPA_SALPK Elongation factor 4 OS=Salmonella paratyphi A (strain AKU_12601) GN=lepA PE=3 SV=1 170 358 2.0E-16
sp|Q5PNC0|LEPA_SALPA Elongation factor 4 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=lepA PE=3 SV=1 170 358 2.0E-16
sp|B5RD51|LEPA_SALG2 Elongation factor 4 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=lepA PE=3 SV=1 170 358 2.0E-16
sp|P0A1W4|LEPA_SALTY Elongation factor 4 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=lepA PE=3 SV=1 170 358 2.0E-16
sp|P0A1W5|LEPA_SALTI Elongation factor 4 OS=Salmonella typhi GN=lepA PE=3 SV=1 170 358 2.0E-16
sp|B4TS16|LEPA_SALSV Elongation factor 4 OS=Salmonella schwarzengrund (strain CVM19633) GN=lepA PE=3 SV=1 170 358 2.0E-16
sp|B4T1G0|LEPA_SALNS Elongation factor 4 OS=Salmonella newport (strain SL254) GN=lepA PE=3 SV=1 170 358 2.0E-16
sp|B4TE17|LEPA_SALHS Elongation factor 4 OS=Salmonella heidelberg (strain SL476) GN=lepA PE=3 SV=1 170 358 2.0E-16
sp|B5QTV0|LEPA_SALEP Elongation factor 4 OS=Salmonella enteritidis PT4 (strain P125109) GN=lepA PE=3 SV=1 170 358 2.0E-16
sp|B5FRC7|LEPA_SALDC Elongation factor 4 OS=Salmonella dublin (strain CT_02021853) GN=lepA PE=3 SV=1 170 358 2.0E-16
sp|Q57LC8|LEPA_SALCH Elongation factor 4 OS=Salmonella choleraesuis (strain SC-B67) GN=lepA PE=3 SV=1 170 358 2.0E-16
sp|B7GJ64|EFG_ANOFW Elongation factor G OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=fusA PE=3 SV=1 167 310 2.0E-15
sp|Q3SLQ2|EFG_THIDA Elongation factor G OS=Thiobacillus denitrificans (strain ATCC 25259) GN=fusA PE=3 SV=1 623 960 9.0E-14
sp|Q7W455|EFG2_BORPA Elongation factor G 2 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=fusA2 PE=3 SV=1 462 960 3.0E-13
sp|Q7WFL2|EFG2_BORBR Elongation factor G 2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=fusA2 PE=3 SV=1 462 960 3.0E-13
sp|Q034X8|EFG_LACC3 Elongation factor G OS=Lactobacillus casei (strain ATCC 334) GN=fusA PE=3 SV=1 477 960 4.0E-13
sp|B3WAM2|EFG_LACCB Elongation factor G OS=Lactobacillus casei (strain BL23) GN=fusA PE=3 SV=1 477 960 5.0E-13
sp|Q1WVA0|EFG_LACS1 Elongation factor G OS=Lactobacillus salivarius (strain UCC118) GN=fusA PE=3 SV=1 541 960 9.0E-13
sp|Q118Z3|EFG1_TRIEI Elongation factor G 1 OS=Trichodesmium erythraeum (strain IMS101) GN=fusA1 PE=3 SV=1 462 960 1.0E-12
sp|Q046C7|EFG_LACGA Elongation factor G OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=fusA PE=3 SV=1 639 960 1.0E-12
sp|B2J5B0|EFG_NOSP7 Elongation factor G OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=fusA PE=3 SV=1 516 960 2.0E-11
sp|Q7U4D2|EFG_SYNPX Elongation factor G OS=Synechococcus sp. (strain WH8102) GN=fusA PE=3 SV=1 514 960 9.0E-10
sp|Q3AMT5|EFG_SYNSC Elongation factor G OS=Synechococcus sp. (strain CC9605) GN=fusA PE=3 SV=1 514 960 3.0E-09
sp|O87844|EFG2_STRCO Elongation factor G 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=fusB PE=3 SV=1 541 960 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0097159 organic cyclic compound binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:1901363 heterocyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0003674 molecular_function No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0016462 pyrophosphatase activity No
GO:0016787 hydrolase activity No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6087
MDDLYDEYADPVSSSIRMAELTRLRFGNFIGEEAASEEASDAGPNEAAHGEIEEQNEDPGTLGLELMEVDGTKAS
RVTGKTASLTLASAADGASNAVVLHEDKQYYPTAEQVYGPDVDTRVEEEDALPLSKPIIAPVEVKKFKIEEADLP
PVFFSRTFMTDLMNFPEQARNVALAGHLHHGKTSFMDMLVLETHDISNRLEKRTGRKREEQLRYTDVHVMERERG
ISIKAAPMSLVLQSTKGKSHLVNIIDTPGHVNFADEIAASFRLVDGLCLVVDVVEGVQVNTEQIIKHAVLEGLPM
TLIINKIDRLILELRLPPKDAYFKLKHVIEEVNTVITNAAPGATAISRRVSPELGNVLFACTDLGWCFTLQSFAQ
MYADKYGGFNVGDLAKRLWGDIYFNPGKRNFTRKPTDSSTPRAFVHFILEPVYKIFTHSITDGPTKLKKVLASLG
VQLKPKQYKADANVILKLVCEQFFGPCKSFVDMILEHVPSPGQGAERLLERHYTGPLDTKIAASMRSCDQAGPLV
VHITKLFSTTDAKSFLSFGRVLSGTARPGMAVRVLGEGYSVDDEEDMTTASIGQVLIAETRYNIVTNGVPAGNMV
LLSGVDNSIVKSATIVAPKLADDEDAHIFQPVTHFTQSVLKVAVEPVNPSELPKMLDGLRKVQKSYPLIDTKVEE
SGEHVIIGTGELYMDCVLHDLRRLYADMDVKVSDPVTRFCETVVETSATKCYAITPNKKNRVTMIAEQLDKGVAS
DIEAGVVKIRDPVRKTANYFEQNHGWDKLAARSVWAFGPDEKGPNVLQDDTLPSEVDKKLLRSVRESIRQGFSWA
TREGPLCEEPIRNTRFKVTDVMLAGEAIYRGGGQIIPTSRRACYSSFLMASPRLMEPMYAVSVTGPEDSYMEVYN
VLARRRGHVLSDGPVAGTPLYRVNGLLPVIDSLGFESDLRIKTQGSSMVSMVFDSWSIVPGDPLDSEVTLRPLQP
ASTQATARDFMLKTRRRKGLSEDVSVKTFLEPEFYANLMESGLLGDA*
Coding >Ophun1|6087
ATGGATGATCTCTACGATGAGTATGCAGACCCTGTTTCCAGCAGCATCAGGATGGCCGAGCTGACGCGTCTTAGG
TTCGGCAACTTCATCGGCGAAGAGGCTGCTTCTGAGGAAGCTTCCGACGCCGGCCCCAACGAAGCCGCTCACGGC
GAAATCGAGGAGCAGAATGAAGATCCTGGGACCTTGGGCCTAGAGCTCATGGAAGTGGACGGTACGAAGGCCTCT
CGCGTGACCGGCAAGACTGCCTCGTTGACTCTCGCATCGGCTGCAGATGGCGCTTCCAACGCCGTCGTTCTTCAC
GAAGATAAGCAGTACTACCCGACTGCAGAGCAGGTCTACGGACCCGATGTCGATACACGTGTCGAGGAGGAGGAC
GCCTTGCCTCTCTCCAAGCCCATCATTGCGCCTGTCGAGGTCAAAAAGTTCAAGATCGAAGAGGCCGACCTGCCG
CCCGTCTTCTTCAGCCGCACCTTTATGACGGACCTGATGAATTTCCCGGAGCAGGCACGGAACGTCGCCCTCGCG
GGCCATCTGCACCACGGTAAGACTTCCTTCATGGACATGCTCGTCTTGGAGACGCACGATATCTCGAACCGCCTC
GAAAAGAGAACCGGCCGCAAGCGTGAGGAGCAGCTACGTTACACCGATGTCCATGTCATGGAGCGCGAACGCGGC
ATTTCCATCAAGGCAGCTCCCATGAGCCTGGTCCTGCAAAGCACAAAGGGCAAGTCGCATCTCGTCAATATCATC
GACACTCCCGGACACGTCAACTTCGCCGACGAGATAGCAGCTTCGTTTCGGCTGGTCGACGGTCTGTGTCTCGTT
GTCGACGTGGTTGAGGGCGTTCAGGTCAATACGGAACAAATCATCAAGCACGCCGTTCTCGAAGGCCTGCCCATG
ACGCTCATCATCAACAAGATCGATCGTCTGATCCTCGAGCTCAGACTGCCTCCCAAAGACGCCTATTTCAAGCTC
AAGCATGTCATTGAGGAGGTAAACACGGTCATTACCAATGCCGCGCCAGGCGCGACGGCCATTTCGAGACGCGTG
AGTCCGGAGTTGGGCAACGTGCTGTTCGCCTGCACCGACCTGGGCTGGTGCTTTACTCTTCAGTCCTTTGCCCAG
ATGTACGCCGACAAATACGGGGGATTCAACGTCGGTGACTTGGCTAAACGGCTCTGGGGGGACATCTATTTCAAT
CCTGGAAAGCGCAACTTTACTCGGAAGCCTACGGATAGTAGCACGCCGAGGGCCTTTGTCCATTTCATCTTGGAG
CCTGTCTACAAGATCTTCACGCACTCCATCACCGACGGCCCGACCAAGCTGAAAAAGGTCTTGGCCTCGCTGGGC
GTCCAGCTGAAGCCAAAGCAGTACAAGGCCGACGCGAACGTCATCCTCAAGCTCGTCTGCGAGCAATTCTTTGGC
CCGTGCAAGAGCTTTGTCGACATGATTCTTGAGCATGTGCCGTCTCCCGGGCAAGGGGCGGAGCGCCTATTGGAG
CGCCACTACACCGGCCCTCTCGACACCAAGATTGCGGCCTCGATGAGGTCTTGCGATCAGGCGGGCCCTCTGGTG
GTGCACATCACCAAGTTGTTCAGCACCACGGACGCCAAAAGCTTCCTCTCATTTGGTCGCGTGCTGAGCGGCACG
GCGCGTCCGGGCATGGCCGTCCGCGTCCTCGGCGAGGGCTACTCGGTCGACGACGAAGAAGATATGACTACAGCC
TCCATCGGGCAGGTGCTCATTGCTGAGACGAGATACAACATCGTGACCAACGGAGTACCGGCCGGTAACATGGTG
CTGCTGAGCGGCGTCGACAACTCCATTGTCAAATCAGCTACCATCGTGGCGCCGAAGCTGGCGGACGACGAGGAC
GCCCACATCTTCCAGCCGGTGACGCATTTTACGCAGTCGGTGCTCAAGGTTGCCGTCGAGCCCGTCAACCCCTCG
GAGCTCCCCAAGATGCTGGACGGGCTTCGAAAGGTGCAAAAGTCGTACCCTCTCATCGACACCAAGGTGGAGGAG
TCTGGCGAGCACGTCATCATCGGCACGGGCGAGCTCTACATGGACTGCGTGTTGCATGATTTGAGACGTCTGTAC
GCCGACATGGACGTCAAGGTGTCTGACCCGGTGACGCGCTTCTGCGAGACGGTGGTCGAGACGTCGGCCACCAAG
TGCTATGCCATTACGCCCAACAAGAAGAACCGCGTCACCATGATCGCCGAACAGCTCGACAAGGGTGTAGCTTCG
GACATTGAGGCGGGCGTGGTCAAGATCCGGGACCCGGTTCGCAAGACGGCCAACTACTTTGAACAGAATCACGGA
TGGGACAAGCTCGCGGCGAGGAGCGTCTGGGCGTTTGGGCCGGACGAAAAGGGGCCAAACGTGCTGCAGGACGAC
ACGCTTCCGTCCGAGGTTGATAAGAAGTTGCTGCGGTCCGTTCGAGAGTCTATCCGCCAGGGATTCAGCTGGGCT
ACTCGCGAGGGCCCTCTGTGCGAAGAGCCGATCCGGAATACCAGGTTCAAGGTGACGGATGTTATGCTGGCCGGC
GAGGCAATTTATCGGGGCGGTGGACAGATCATCCCCACGTCACGACGCGCTTGCTATTCGTCGTTTCTGATGGCG
TCTCCGCGGCTGATGGAGCCCATGTACGCCGTGTCGGTTACTGGACCGGAAGACTCGTACATGGAAGTGTACAAT
GTGCTGGCGCGCCGGCGAGGCCACGTTCTCTCGGACGGTCCTGTGGCCGGGACGCCGCTGTACCGAGTCAACGGG
CTGCTGCCAGTCATCGACAGCCTCGGTTTCGAATCGGACTTGCGCATCAAGACTCAGGGCAGCTCCATGGTGAGC
ATGGTGTTTGACAGCTGGAGCATCGTGCCCGGAGACCCGCTGGACAGCGAGGTTACGCTCCGGCCTCTGCAGCCG
GCCTCGACGCAGGCCACAGCTCGCGACTTTATGCTCAAGACGAGGCGACGCAAGGGCTTGAGCGAGGACGTGAGC
GTCAAGACGTTCCTGGAGCCCGAGTTTTACGCGAACCTGATGGAGAGCGGCCTGCTGGGAGATGCGTGA
Transcript >Ophun1|6087
ATGGATGATCTCTACGATGAGTATGCAGACCCTGTTTCCAGCAGCATCAGGATGGCCGAGCTGACGCGTCTTAGG
TTCGGCAACTTCATCGGCGAAGAGGCTGCTTCTGAGGAAGCTTCCGACGCCGGCCCCAACGAAGCCGCTCACGGC
GAAATCGAGGAGCAGAATGAAGATCCTGGGACCTTGGGCCTAGAGCTCATGGAAGTGGACGGTACGAAGGCCTCT
CGCGTGACCGGCAAGACTGCCTCGTTGACTCTCGCATCGGCTGCAGATGGCGCTTCCAACGCCGTCGTTCTTCAC
GAAGATAAGCAGTACTACCCGACTGCAGAGCAGGTCTACGGACCCGATGTCGATACACGTGTCGAGGAGGAGGAC
GCCTTGCCTCTCTCCAAGCCCATCATTGCGCCTGTCGAGGTCAAAAAGTTCAAGATCGAAGAGGCCGACCTGCCG
CCCGTCTTCTTCAGCCGCACCTTTATGACGGACCTGATGAATTTCCCGGAGCAGGCACGGAACGTCGCCCTCGCG
GGCCATCTGCACCACGGTAAGACTTCCTTCATGGACATGCTCGTCTTGGAGACGCACGATATCTCGAACCGCCTC
GAAAAGAGAACCGGCCGCAAGCGTGAGGAGCAGCTACGTTACACCGATGTCCATGTCATGGAGCGCGAACGCGGC
ATTTCCATCAAGGCAGCTCCCATGAGCCTGGTCCTGCAAAGCACAAAGGGCAAGTCGCATCTCGTCAATATCATC
GACACTCCCGGACACGTCAACTTCGCCGACGAGATAGCAGCTTCGTTTCGGCTGGTCGACGGTCTGTGTCTCGTT
GTCGACGTGGTTGAGGGCGTTCAGGTCAATACGGAACAAATCATCAAGCACGCCGTTCTCGAAGGCCTGCCCATG
ACGCTCATCATCAACAAGATCGATCGTCTGATCCTCGAGCTCAGACTGCCTCCCAAAGACGCCTATTTCAAGCTC
AAGCATGTCATTGAGGAGGTAAACACGGTCATTACCAATGCCGCGCCAGGCGCGACGGCCATTTCGAGACGCGTG
AGTCCGGAGTTGGGCAACGTGCTGTTCGCCTGCACCGACCTGGGCTGGTGCTTTACTCTTCAGTCCTTTGCCCAG
ATGTACGCCGACAAATACGGGGGATTCAACGTCGGTGACTTGGCTAAACGGCTCTGGGGGGACATCTATTTCAAT
CCTGGAAAGCGCAACTTTACTCGGAAGCCTACGGATAGTAGCACGCCGAGGGCCTTTGTCCATTTCATCTTGGAG
CCTGTCTACAAGATCTTCACGCACTCCATCACCGACGGCCCGACCAAGCTGAAAAAGGTCTTGGCCTCGCTGGGC
GTCCAGCTGAAGCCAAAGCAGTACAAGGCCGACGCGAACGTCATCCTCAAGCTCGTCTGCGAGCAATTCTTTGGC
CCGTGCAAGAGCTTTGTCGACATGATTCTTGAGCATGTGCCGTCTCCCGGGCAAGGGGCGGAGCGCCTATTGGAG
CGCCACTACACCGGCCCTCTCGACACCAAGATTGCGGCCTCGATGAGGTCTTGCGATCAGGCGGGCCCTCTGGTG
GTGCACATCACCAAGTTGTTCAGCACCACGGACGCCAAAAGCTTCCTCTCATTTGGTCGCGTGCTGAGCGGCACG
GCGCGTCCGGGCATGGCCGTCCGCGTCCTCGGCGAGGGCTACTCGGTCGACGACGAAGAAGATATGACTACAGCC
TCCATCGGGCAGGTGCTCATTGCTGAGACGAGATACAACATCGTGACCAACGGAGTACCGGCCGGTAACATGGTG
CTGCTGAGCGGCGTCGACAACTCCATTGTCAAATCAGCTACCATCGTGGCGCCGAAGCTGGCGGACGACGAGGAC
GCCCACATCTTCCAGCCGGTGACGCATTTTACGCAGTCGGTGCTCAAGGTTGCCGTCGAGCCCGTCAACCCCTCG
GAGCTCCCCAAGATGCTGGACGGGCTTCGAAAGGTGCAAAAGTCGTACCCTCTCATCGACACCAAGGTGGAGGAG
TCTGGCGAGCACGTCATCATCGGCACGGGCGAGCTCTACATGGACTGCGTGTTGCATGATTTGAGACGTCTGTAC
GCCGACATGGACGTCAAGGTGTCTGACCCGGTGACGCGCTTCTGCGAGACGGTGGTCGAGACGTCGGCCACCAAG
TGCTATGCCATTACGCCCAACAAGAAGAACCGCGTCACCATGATCGCCGAACAGCTCGACAAGGGTGTAGCTTCG
GACATTGAGGCGGGCGTGGTCAAGATCCGGGACCCGGTTCGCAAGACGGCCAACTACTTTGAACAGAATCACGGA
TGGGACAAGCTCGCGGCGAGGAGCGTCTGGGCGTTTGGGCCGGACGAAAAGGGGCCAAACGTGCTGCAGGACGAC
ACGCTTCCGTCCGAGGTTGATAAGAAGTTGCTGCGGTCCGTTCGAGAGTCTATCCGCCAGGGATTCAGCTGGGCT
ACTCGCGAGGGCCCTCTGTGCGAAGAGCCGATCCGGAATACCAGGTTCAAGGTGACGGATGTTATGCTGGCCGGC
GAGGCAATTTATCGGGGCGGTGGACAGATCATCCCCACGTCACGACGCGCTTGCTATTCGTCGTTTCTGATGGCG
TCTCCGCGGCTGATGGAGCCCATGTACGCCGTGTCGGTTACTGGACCGGAAGACTCGTACATGGAAGTGTACAAT
GTGCTGGCGCGCCGGCGAGGCCACGTTCTCTCGGACGGTCCTGTGGCCGGGACGCCGCTGTACCGAGTCAACGGG
CTGCTGCCAGTCATCGACAGCCTCGGTTTCGAATCGGACTTGCGCATCAAGACTCAGGGCAGCTCCATGGTGAGC
ATGGTGTTTGACAGCTGGAGCATCGTGCCCGGAGACCCGCTGGACAGCGAGGTTACGCTCCGGCCTCTGCAGCCG
GCCTCGACGCAGGCCACAGCTCGCGACTTTATGCTCAAGACGAGGCGACGCAAGGGCTTGAGCGAGGACGTGAGC
GTCAAGACGTTCCTGGAGCCCGAGTTTTACGCGAACCTGATGGAGAGCGGCCTGCTGGGAGATGCGTGA
Gene >Ophun1|6087
ATGGATGATCTCTACGATGAGTATGCAGACCCTGTTTCCAGCAGCATCAGGATGGCCGAGCTGACGCGTCTTAGG
TTCGGCAACTTCATCGGCGAAGAGGCTGCTTCTGAGGAAGCTTCCGACGCCGGCCCCAACGAAGCCGCTCACGGC
GAAATCGAGGAGCAGAATGAAGATCCTGGGACCTTGGGCCTAGAGCTCATGGAAGTGGACGGTACGAAGGCCTCT
CGCGTGACCGGCAAGACTGCCTCGTTGACTCTCGCATCGGCTGCAGATGGCGCTTCCAACGCCGTCGTTCTTCAC
GAAGATAAGCAGTACTACCCGACTGCAGAGCAGGTCTACGGACCCGATGTCGATACACGTGTCGAGGAGGAGGAC
GCCTTGCCTCTCTCCAAGCCCATCATTGCGCCTGTCGAGGTCAAAAAGTTCAAGATCGAAGAGGCCGACCTGCCG
CCCGTCTTCTTCAGCCGCACCTTTATGACGGACCTGATGAATTTCCCGGAGCAGGCACGGAACGTCGCCCTCGCG
GGCCATCTGCACCACGGTAAGACTTCCTTCATGGACATGCTCGTCTTGGAGACGCACGATATCTCGAACCGCCTC
GAAAAGAGAACCGGCCGCAAGCGTGAGGAGCAGCTACGTTACACCGATGTCCATGTCATGGAGCGCGAACGCGGC
ATTTCCATCAAGGCAGCTCCCATGAGCCTGGTCCTGCAAAGCACAAAGGGCAAGTCGCATCTCGTCAATATCATC
GACACTCCCGGACACGTCAACTTCGCCGACGAGATAGCAGCTTCGTTTCGGCTGGTCGACGGTCTGTGTCTCGTT
GTCGACGTGGTTGAGGGCGTTCAGGTCAATACGGAACAAATCATCAAGCACGCCGTTCTCGAAGGCCTGCCCATG
ACGCTCATCATCAACAAGATCGATCGTCTGATCCTCGAGCTCAGACTGCCTCCCAAAGACGCCTATTTCAAGCTC
AAGCATGTCATTGAGGAGGTAAACACGGTCATTACCAATGCCGCGCCAGGCGCGACGGCCATTTCGAGACGCGTG
AGTCCGGAGTTGGGCAACGTGCTGTTCGCCTGCACCGACCTGGGCTGGTGCTTTACTCTTCAGTCCTTTGCCCAG
ATGTACGCCGACAAATACGGGGGATTCAACGTCGGTGACTTGGCTAAACGGCTCTGGGGGGACATCTATTTCAAT
CCTGGAAAGCGCAACTTTACTCGGAAGCCTACGGATAGTAGCACGCCGAGGGCCTTTGTCCATTTCATCTTGGAG
CCTGTCTACAAGATCTTCACGCACTCCATCACCGACGGCCCGACCAAGCTGAAAAAGGTCTTGGCCTCGCTGGGC
GTCCAGCTGAAGCCAAAGCAGTACAAGGCCGACGCGAACGTCATCCTCAAGCTCGTCTGCGAGCAATTCTTTGGC
CCGTGCAAGAGCTTTGTCGACATGATTCTTGAGCATGTGCCGTCTCCCGGGCAAGGGGCGGAGCGCCTATTGGAG
CGCCACTACACCGGCCCTCTCGACACCAAGATTGCGGCCTCGATGAGGTCTTGCGATCAGGCGGGCCCTCTGGTG
GTGCACATCACCAAGTTGTTCAGCACCACGGACGCCAAAAGCTTCCTCTCATTTGGTCGCGTGCTGAGCGGCACG
GCGCGTCCGGGCATGGCCGTCCGCGTCCTCGGCGAGGGCTACTCGGTCGACGACGAAGAAGATATGACTACAGCC
TCCATCGGGCAGGTGCTCATTGCTGAGACGAGATACAACATCGTGACCAACGGAGTACCGGCCGGTAACATGGTG
CTGCTGAGCGGCGTCGACAACTCCATTGTCAAATCAGCTACCATCGTGGCGCCGAAGCTGGCGGACGACGAGGAC
GCCCACATCTTCCAGCCGGTGACGCATTTTACGCAGTCGGTGCTCAAGGTTGCCGTCGAGCCCGTCAACCCCTCG
GAGCTCCCCAAGATGCTGGACGGGCTTCGAAAGGTGCAAAAGTCGTACCCTCTCATCGACACCAAGGTGGAGGAG
TCTGGCGAGCACGTCATCATCGGCACGGGCGAGCTCTACATGGACTGCGTGTTGCATGATTTGAGACGTCTGTAC
GCCGACATGGACGTCAAGGTGTCTGACCCGGTGACGCGCTTCTGCGAGACGGTGGTCGAGACGTCGGCCACCAAG
TGCTATGCCATTACGCCCAACAAGAAGAACCGCGTCACCATGATCGCCGAACAGCTCGACAAGGGTGTAGCTTCG
GACATTGAGGCGGGCGTGGTCAAGATCCGGGACCCGGTTCGCAAGACGGCCAACTACTTTGAACAGAATCACGGA
TGGGACAAGCTCGCGGCGAGGAGCGTCTGGGCGTTTGGGCCGGACGAAAAGGGGCCAAACGTGCTGCAGGACGAC
ACGCTTCCGTCCGAGGTGAGGACGCCACGTTGTGAGACTTGAGGAATATGGCTGACGTCGCAACAGGTTGATAAG
AAGTTGCTGCGGTCCGTTCGAGAGTCTATCCGCCAGGGATTCAGCTGGGCTACTCGCGAGGGCCCTCTGTGCGAA
GAGCGTACGTATTCCTCTCCCCTCGCGCCTATGTGACTCTTGGGCTGCGGTCGTATCAGAATATGACTTGCTGAC
GGTTTCTGCAGCGATCCGGAATACCAGGTTCAAGGTGACGGATGTTATGCTGGCCGGCGAGGCAATTTATCGGGG
CGGTGGACAGATCATCCCCACGTCACGACGCGCTTGCTATTCGTCGTTTCTGATGGCGTCTCCGCGGCTGATGGA
GCCCATGTACGCCGTGTCGGTTACTGGACCGGAAGACTCGTACATGGAAGTGTACAATGTGCTGGCGCGCCGGCG
AGGCCACGTTCTCTCGGACGGTCCTGTGGCCGGGACGCCGCTGTACCGAGTCAACGGGCTGCTGCCAGTCATCGA
CAGCCTCGGTTTCGAATCGGACTTGCGCATCAAGACTCAGGGCAGCTCCATGGTGAGCATGGTGTTTGACAGCTG
GAGCATCGTGCCCGGAGACCCGCTGGACAGCGAGGTTACGCTCCGGCCTCTGCAGCCGGCCTCGACGCAGGCCAC
AGCTCGCGACTTTATGCTCAAGACGAGGCGACGCAAGGGCTTGAGCGAGGACGTGAGCGTCAAGACGTTCCTGGA
GCCCGAGTTTTACGCGAACCTGATGGAGAGCGGCCTGCTGGGAGATGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail