Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6086
Gene name
LocationContig_64:27350..30304
Strand+
Gene length (bp)2954
Transcript length (bp)2625
Coding sequence length (bp)2625
Protein length (aa) 875

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04734 Ceramidase_alk Neutral/alkaline non-lysosomal ceramidase, N-terminal 2.1E-187 183 705
PF17048 Ceramidse_alk_C Neutral/alkaline non-lysosomal ceramidase, C-terminal 7.4E-47 711 870

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q304B9|NCASE_ARATH Neutral ceramidase OS=Arabidopsis thaliana GN=At2g38010 PE=3 SV=1 183 854 2.0E-124
sp|Q5W7F1|ASAH2_DANRE Neutral ceramidase OS=Danio rerio GN=asah2 PE=1 SV=1 171 871 2.0E-113
sp|Q54BK2|NCSEA_DICDI Neutral ceramidase A OS=Dictyostelium discoideum GN=dcd2A PE=1 SV=1 178 859 3.0E-109
sp|Q55G11|NCSEB_DICDI Neutral ceramidase B OS=Dictyostelium discoideum GN=dcd2B PE=3 SV=1 171 869 4.0E-108
sp|Q9VA70|NCASE_DROME Neutral ceramidase OS=Drosophila melanogaster GN=CDase PE=1 SV=1 180 871 1.0E-105
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q304B9|NCASE_ARATH Neutral ceramidase OS=Arabidopsis thaliana GN=At2g38010 PE=3 SV=1 183 854 2.0E-124
sp|Q5W7F1|ASAH2_DANRE Neutral ceramidase OS=Danio rerio GN=asah2 PE=1 SV=1 171 871 2.0E-113
sp|Q54BK2|NCSEA_DICDI Neutral ceramidase A OS=Dictyostelium discoideum GN=dcd2A PE=1 SV=1 178 859 3.0E-109
sp|Q55G11|NCSEB_DICDI Neutral ceramidase B OS=Dictyostelium discoideum GN=dcd2B PE=3 SV=1 171 869 4.0E-108
sp|Q9VA70|NCASE_DROME Neutral ceramidase OS=Drosophila melanogaster GN=CDase PE=1 SV=1 180 871 1.0E-105
sp|Q29C43|NCASE_DROPS Neutral ceramidase OS=Drosophila pseudoobscura pseudoobscura GN=CDase PE=3 SV=1 180 871 6.0E-103
sp|Q9NR71|ASAH2_HUMAN Neutral ceramidase OS=Homo sapiens GN=ASAH2 PE=1 SV=2 183 871 9.0E-102
sp|Q9JHE3|ASAH2_MOUSE Neutral ceramidase OS=Mus musculus GN=Asah2 PE=1 SV=1 162 872 5.0E-100
sp|Q91XT9|ASAH2_RAT Neutral ceramidase OS=Rattus norvegicus GN=Asah2 PE=1 SV=1 177 872 1.0E-92
sp|Q9I596|NCASE_PSEAE Neutral ceramidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA0845 PE=1 SV=1 183 871 2.0E-86
sp|O06769|NCASE_MYCTU Neutral ceramidase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0669c PE=1 SV=1 185 872 1.0E-76
sp|Q0JL46|NCASE_ORYSJ Neutral ceramidase OS=Oryza sativa subsp. japonica GN=Os01g0624000 PE=1 SV=1 406 871 4.0E-72
sp|Q0JL46|NCASE_ORYSJ Neutral ceramidase OS=Oryza sativa subsp. japonica GN=Os01g0624000 PE=1 SV=1 183 417 3.0E-40
sp|P0C7U1|ASA2B_HUMAN Putative inactive neutral ceramidase B OS=Homo sapiens GN=ASAH2B PE=2 SV=1 753 873 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6086
MSVKSRSAPSPPSSSDFQESPQINAEPVVAESIVAEPPVAQPPVAKPIVANPSVAKPSVAKPPVVADGFTGVSPS
RQLPGRIFEKPQPRPQPSVLALPVAKPFVAEPSVVSGGLAGASPSRQPPERTFKKQQPRPQPSVLEPPVFGPSVV
PDGFTGTGSGRQPPERTFKNQQPRPQPSQSNRFLIGVGKADITGPVAELVMAGYAHDDQIASGLRQRIYSRAFII
ADVNRPQERLLYLVLDNINSDTSIRTGLLEALANGGDELSYYNQHNLALSSVHSHSGPSTGWNYFLAQVPQSGFD
RQGQQAVIDGALLSIKRAQSGLQEGYLDLAEIDIPDASVSRSLWAYLANPVEERAKYGREIDTTMTGLRFRQASD
GKTKAILTWFPVHGTSLYGNNTHISGDNKGLASWMLEQKLRQSPAFTKDFIGAFGQANEADVSPNTDGAWCEDGS
GQPCNYTDSSCPDGLVTKCHGRGPMFRALDLGVSSCHEIARRQAVKAEEMLVSPLTRWTPIDAQLGVKGYHFYHD
MAFWRFKTLEGREAMTCPAALGFSFAAGTTDGPGLFDFVQGDANPVPKNPLWTFAFGFVKAASRRQKICQVPKPI
LFNGGQLSSPYDWSPNIVDVAMFRIGQLFIILSPSELTTMSGRRWKEAIRKEADKFIQRVRPIVVAASPVNSYSH
YLATKEEYDIQRYEGASTLFGRWQLDAFMNLSVSSMPYLVPGNQNFPEQGTLPPDNRKKSFNSNNPVSPDLRSRT
PGYGAVLRQPNPRYVIGQNVQATFQGANPRNNLRLEDTFAAVEQLGKDGKWTRVRDDDDWFLVFTWRRTGNFFKR
TEEVDITWETKGNAKPGIYRLKYYGDAKTRYQGLQPIEGTSNSFSLTAR*
Coding >Ophun1|6086
ATGTCAGTAAAAAGCCGCTCCGCTCCCAGTCCGCCAAGTTCTTCCGATTTCCAAGAAAGTCCGCAGATCAACGCT
GAGCCGGTTGTCGCTGAGTCGATTGTCGCTGAGCCACCTGTCGCTCAGCCGCCTGTCGCCAAGCCGATTGTCGCC
AATCCGTCAGTCGCCAAGCCGTCAGTCGCCAAGCCGCCTGTCGTCGCGGATGGCTTCACCGGCGTCAGTCCCAGT
CGACAGCTTCCGGGGCGCATCTTCGAAAAGCCGCAACCAAGACCTCAGCCCTCTGTCCTTGCGCTGCCTGTTGCT
AAGCCCTTTGTCGCTGAGCCCTCTGTCGTCTCGGGCGGCCTCGCTGGCGCCAGCCCCAGTCGACAGCCTCCGGAG
CGTACCTTCAAGAAGCAGCAGCCGAGGCCTCAACCCTCTGTCCTTGAGCCGCCTGTCTTCGGGCCCTCTGTCGTC
CCGGATGGCTTCACAGGCACCGGCTCCGGTCGACAGCCTCCGGAGCGCACATTCAAGAACCAGCAACCAAGGCCT
CAACCCTCTCAAAGCAACAGGTTTCTCATCGGCGTCGGCAAAGCCGACATCACTGGACCCGTCGCCGAGCTCGTC
ATGGCTGGCTATGCGCACGACGACCAAATAGCATCGGGGCTCCGACAGCGTATATACAGTCGAGCTTTCATCATT
GCCGATGTCAACAGGCCACAAGAGCGCCTACTGTATCTGGTTCTTGACAATATCAACAGTGACACGTCCATCCGT
ACCGGTCTCCTCGAAGCACTTGCTAACGGTGGGGACGAACTGTCCTACTACAATCAACACAACCTTGCCCTCTCG
TCTGTTCACAGCCACTCTGGTCCCTCAACCGGCTGGAATTACTTTTTGGCTCAGGTCCCACAGTCTGGATTCGAT
CGCCAGGGTCAACAGGCTGTCATCGATGGCGCGCTTCTTTCCATCAAACGAGCCCAAAGCGGTCTGCAAGAGGGT
TATCTCGATCTCGCTGAAATCGACATCCCCGATGCCAGCGTCAGTCGCTCTCTATGGGCCTATCTTGCCAACCCG
GTCGAGGAGAGAGCCAAATATGGGCGAGAGATAGACACCACAATGACTGGGCTTCGTTTCCGGCAGGCATCGGAT
GGCAAGACCAAAGCCATCTTGACCTGGTTTCCCGTTCATGGCACCTCTCTCTACGGTAATAACACGCATATATCA
GGCGACAACAAGGGTCTGGCTTCTTGGATGCTCGAGCAGAAGCTACGTCAGTCTCCCGCCTTCACAAAGGACTTT
ATCGGTGCTTTCGGCCAAGCAAATGAGGCCGACGTCTCCCCCAACACCGACGGGGCCTGGTGCGAGGACGGCTCC
GGACAGCCGTGCAACTACACCGACTCTTCATGTCCCGACGGCCTGGTAACAAAATGCCACGGTAGAGGTCCCATG
TTTCGGGCCTTGGACTTGGGCGTCAGCAGCTGCCACGAGATCGCCCGGCGACAGGCTGTCAAAGCCGAGGAAATG
TTGGTTTCGCCCCTCACTCGTTGGACACCGATCGATGCGCAACTCGGTGTCAAAGGCTACCACTTCTATCACGAT
ATGGCCTTTTGGAGATTCAAGACACTAGAAGGTCGCGAGGCCATGACGTGTCCCGCTGCCCTGGGATTCTCTTTT
GCTGCCGGCACGACTGATGGCCCAGGGCTATTCGACTTTGTCCAGGGGGACGCTAATCCGGTGCCCAAGAATCCG
CTGTGGACATTCGCCTTTGGCTTCGTCAAGGCTGCCAGCCGAAGACAGAAAATCTGCCAAGTGCCCAAGCCCATC
TTATTCAACGGCGGCCAACTATCGTCTCCTTACGATTGGTCGCCCAACATCGTCGACGTTGCCATGTTTCGGATC
GGCCAGCTATTCATTATTCTCAGCCCGAGCGAACTGACCACCATGAGCGGTCGACGATGGAAAGAGGCCATCAGA
AAGGAAGCCGACAAGTTTATCCAACGTGTCCGCCCTATCGTCGTCGCTGCCAGCCCGGTCAACTCTTACTCCCAT
TATCTCGCGACCAAGGAGGAGTACGACATTCAGCGGTACGAAGGGGCCTCGACTTTGTTTGGCCGCTGGCAGCTT
GACGCCTTCATGAACCTGAGTGTCAGTAGCATGCCGTATCTGGTGCCGGGCAACCAAAATTTTCCAGAGCAAGGC
ACGCTGCCTCCGGATAACCGGAAAAAATCGTTCAACAGCAACAATCCCGTCTCCCCAGACCTCAGATCGCGGACA
CCGGGGTATGGAGCGGTCCTGAGACAGCCTAATCCAAGATACGTCATCGGACAAAACGTGCAAGCCACTTTCCAA
GGGGCGAATCCTCGTAACAACCTACGGTTAGAAGATACATTCGCCGCGGTCGAGCAACTCGGCAAAGACGGGAAG
TGGACGCGCGTACGCGATGATGATGACTGGTTCCTAGTATTCACATGGCGGAGGACAGGTAACTTCTTCAAGCGG
ACCGAGGAGGTCGACATAACGTGGGAAACAAAGGGAAACGCGAAGCCGGGAATCTATCGGCTCAAGTATTACGGC
GATGCGAAGACGAGATACCAGGGACTTCAGCCAATCGAGGGCACGAGCAACAGTTTTTCGCTGACTGCCAGGTAA
Transcript >Ophun1|6086
ATGTCAGTAAAAAGCCGCTCCGCTCCCAGTCCGCCAAGTTCTTCCGATTTCCAAGAAAGTCCGCAGATCAACGCT
GAGCCGGTTGTCGCTGAGTCGATTGTCGCTGAGCCACCTGTCGCTCAGCCGCCTGTCGCCAAGCCGATTGTCGCC
AATCCGTCAGTCGCCAAGCCGTCAGTCGCCAAGCCGCCTGTCGTCGCGGATGGCTTCACCGGCGTCAGTCCCAGT
CGACAGCTTCCGGGGCGCATCTTCGAAAAGCCGCAACCAAGACCTCAGCCCTCTGTCCTTGCGCTGCCTGTTGCT
AAGCCCTTTGTCGCTGAGCCCTCTGTCGTCTCGGGCGGCCTCGCTGGCGCCAGCCCCAGTCGACAGCCTCCGGAG
CGTACCTTCAAGAAGCAGCAGCCGAGGCCTCAACCCTCTGTCCTTGAGCCGCCTGTCTTCGGGCCCTCTGTCGTC
CCGGATGGCTTCACAGGCACCGGCTCCGGTCGACAGCCTCCGGAGCGCACATTCAAGAACCAGCAACCAAGGCCT
CAACCCTCTCAAAGCAACAGGTTTCTCATCGGCGTCGGCAAAGCCGACATCACTGGACCCGTCGCCGAGCTCGTC
ATGGCTGGCTATGCGCACGACGACCAAATAGCATCGGGGCTCCGACAGCGTATATACAGTCGAGCTTTCATCATT
GCCGATGTCAACAGGCCACAAGAGCGCCTACTGTATCTGGTTCTTGACAATATCAACAGTGACACGTCCATCCGT
ACCGGTCTCCTCGAAGCACTTGCTAACGGTGGGGACGAACTGTCCTACTACAATCAACACAACCTTGCCCTCTCG
TCTGTTCACAGCCACTCTGGTCCCTCAACCGGCTGGAATTACTTTTTGGCTCAGGTCCCACAGTCTGGATTCGAT
CGCCAGGGTCAACAGGCTGTCATCGATGGCGCGCTTCTTTCCATCAAACGAGCCCAAAGCGGTCTGCAAGAGGGT
TATCTCGATCTCGCTGAAATCGACATCCCCGATGCCAGCGTCAGTCGCTCTCTATGGGCCTATCTTGCCAACCCG
GTCGAGGAGAGAGCCAAATATGGGCGAGAGATAGACACCACAATGACTGGGCTTCGTTTCCGGCAGGCATCGGAT
GGCAAGACCAAAGCCATCTTGACCTGGTTTCCCGTTCATGGCACCTCTCTCTACGGTAATAACACGCATATATCA
GGCGACAACAAGGGTCTGGCTTCTTGGATGCTCGAGCAGAAGCTACGTCAGTCTCCCGCCTTCACAAAGGACTTT
ATCGGTGCTTTCGGCCAAGCAAATGAGGCCGACGTCTCCCCCAACACCGACGGGGCCTGGTGCGAGGACGGCTCC
GGACAGCCGTGCAACTACACCGACTCTTCATGTCCCGACGGCCTGGTAACAAAATGCCACGGTAGAGGTCCCATG
TTTCGGGCCTTGGACTTGGGCGTCAGCAGCTGCCACGAGATCGCCCGGCGACAGGCTGTCAAAGCCGAGGAAATG
TTGGTTTCGCCCCTCACTCGTTGGACACCGATCGATGCGCAACTCGGTGTCAAAGGCTACCACTTCTATCACGAT
ATGGCCTTTTGGAGATTCAAGACACTAGAAGGTCGCGAGGCCATGACGTGTCCCGCTGCCCTGGGATTCTCTTTT
GCTGCCGGCACGACTGATGGCCCAGGGCTATTCGACTTTGTCCAGGGGGACGCTAATCCGGTGCCCAAGAATCCG
CTGTGGACATTCGCCTTTGGCTTCGTCAAGGCTGCCAGCCGAAGACAGAAAATCTGCCAAGTGCCCAAGCCCATC
TTATTCAACGGCGGCCAACTATCGTCTCCTTACGATTGGTCGCCCAACATCGTCGACGTTGCCATGTTTCGGATC
GGCCAGCTATTCATTATTCTCAGCCCGAGCGAACTGACCACCATGAGCGGTCGACGATGGAAAGAGGCCATCAGA
AAGGAAGCCGACAAGTTTATCCAACGTGTCCGCCCTATCGTCGTCGCTGCCAGCCCGGTCAACTCTTACTCCCAT
TATCTCGCGACCAAGGAGGAGTACGACATTCAGCGGTACGAAGGGGCCTCGACTTTGTTTGGCCGCTGGCAGCTT
GACGCCTTCATGAACCTGAGTGTCAGTAGCATGCCGTATCTGGTGCCGGGCAACCAAAATTTTCCAGAGCAAGGC
ACGCTGCCTCCGGATAACCGGAAAAAATCGTTCAACAGCAACAATCCCGTCTCCCCAGACCTCAGATCGCGGACA
CCGGGGTATGGAGCGGTCCTGAGACAGCCTAATCCAAGATACGTCATCGGACAAAACGTGCAAGCCACTTTCCAA
GGGGCGAATCCTCGTAACAACCTACGGTTAGAAGATACATTCGCCGCGGTCGAGCAACTCGGCAAAGACGGGAAG
TGGACGCGCGTACGCGATGATGATGACTGGTTCCTAGTATTCACATGGCGGAGGACAGGTAACTTCTTCAAGCGG
ACCGAGGAGGTCGACATAACGTGGGAAACAAAGGGAAACGCGAAGCCGGGAATCTATCGGCTCAAGTATTACGGC
GATGCGAAGACGAGATACCAGGGACTTCAGCCAATCGAGGGCACGAGCAACAGTTTTTCGCTGACTGCCAGGTAA
Gene >Ophun1|6086
ATGTCAGTAAAAAGCCGCTCCGCTCCCAGTCCGCCAAGTTCTTGTGAGCGCAACTTGCGAAGGTCCAGCCAAGAT
GGTTTCTTTGCGCCCTGCTCTGACGGCTCTGCGGCCTCGCTTGCTTGTCTGGCTGTTGCTCGTGCTCTGTCTTGG
TGATGCATTCGCTCTCTCTGATCAGTCTCCTCGAAACGACCAAGGCGGGCTTGTTCCAGATACCTCGCCGCCCCA
ACTTGAGCTGGCTTCTGTCCCAGCCGATTTCCAAGAAAGTCCGCAGATCAACGCTGAGCCGGTTGTCGCTGAGTC
GATTGTCGCTGAGCCACCTGTCGCTCAGCCGCCTGTCGCCAAGCCGATTGTCGCCAATCCGTCAGTCGCCAAGCC
GTCAGTCGCCAAGCCGCCTGTCGTCGCGGATGGCTTCACCGGCGTCAGTCCCAGTCGACAGCTTCCGGGGCGCAT
CTTCGAAAAGCCGCAACCAAGACCTCAGCCCTCTGTCCTTGCGCTGCCTGTTGCTAAGCCCTTTGTCGCTGAGCC
CTCTGTCGTCTCGGGCGGCCTCGCTGGCGCCAGCCCCAGTCGACAGCCTCCGGAGCGTACCTTCAAGAAGCAGCA
GCCGAGGCCTCAACCCTCTGTCCTTGAGCCGCCTGTCTTCGGGCCCTCTGTCGTCCCGGATGGCTTCACAGGCAC
CGGCTCCGGTCGACAGCCTCCGGAGCGCACATTCAAGAACCAGCAACCAAGGCCTCAACCCTCTCAAAGCAACAG
GTTTCTCATCGGCGTCGGCAAAGCCGACATCACTGGACCCGTCGCCGAGCTCGTCATGGCTGGCTATGCGCACGA
CGACCAAATAGCATCGGGGCTCCGACAGCGTATATACAGTCGAGCTTTCATCATTGCCGATGTCAACAGGCCACA
AGAGCGCCTACTGTATCTGGTTCTTGACAATATCAACAGTGACACGTCCATCCGTACCGGTCTCCTCGAAGCACT
TGCTAACGGTGGGGACGAACTGTCCTACTACAATCAACACAACCTTGCCCTCTCGTCTGTTCACAGCCACTCTGG
TCCCTCAACCGGCTGGAATTACTTTTTGGCTCAGGTCCCACAGTCTGGATTCGATCGCCAGGGTCAACAGGCTGT
CATCGATGGCGCGCTTCTTTCCATCAAACGAGCCCAAAGCGGTCTGCAAGAGGTGAGTCTTGCCCTTTACGAGGT
GTTTTGCTCTTTGTCTCGACGTCCATTAACCCGCACAGGGTTATCTCGATCTCGCTGAAATCGACATCCCCGATG
CCAGCGTCAGTCGCTCTCTATGGGCCTATCTTGCCAACCCGGTCGAGGAGAGAGCCAAATATGGGCGAGAGATAG
ACACCACAATGACTGGGCTTCGTTTCCGGCAGGCATCGGATGGCAAGACCAAAGCCATCTTGACCTGGTTTCCCG
TTCATGGCACCTCTCTCTACGGTAATAACACGCATATATCAGGCGACAACAAGGGTCTGGCTTCTTGGATGCTCG
AGCAGAAGCTACGTCAGTCTCCCGCCTTCACAAAGGACTTTATCGGTGCTTTCGGCCAAGCAAATGAGGCCGACG
TCTCCCCCAACACCGACGGGGCCTGGTGCGAGGACGGCTCCGGACAGCCGTGCAACTACACCGACTCTTCATGTC
CCGACGGCCTGGTAACAAAATGCCACGGTAGAGGTCCCATGTTTCGGGCCTTGGACTTGGGCGTCAGCAGCTGCC
ACGAGATCGCCCGGCGACAGGCTGTCAAAGCCGAGGAAATGTTGGTAAGTGAAACGCCCCTAGTCATCCATGCCG
TTCGTCTATCTGACTGCTGTTGCGTTTTCCAGGTTTCGCCCCTCACTCGTTGGACACCGATCGATGCGCAACTCG
GTGTCAAAGGCTACCACTTCTATCACGATATGGCCTTTTGGAGATTCAAGACACTAGAAGGTCGCGAGGCCATGA
CGTGTCCCGCTGCCCTGGGATTCTCTTTTGCTGCCGGCACGACTGATGGCCCAGGGCTATTCGACTTTGTCCAGG
GGGACGCTAATCCGGTGCCCAAGAATCCGCTGTGGACATTCGCCTTTGGCTTCGTCAAGGCTGCCAGCCGAAGAC
AGAAAATCTGCCAAGTGCCCAAGCCCATCTTATTCAACGGCGGCCAACTATCGTCTCCTTACGATTGGTCGCCCA
ACATCGTCGACGTTGCCATGTTTCGGATCGGCCAGCTATTCATTATTCTCAGCCCGAGCGAACTGACCACCATGA
GCGGTCGACGATGGAAAGAGGCCATCAGAAAGGAAGCCGACAAGTTTATCCAACGTGTCCGCCCTATCGTCGTCG
CTGCCAGCCCGGTCAACTCTTACTCCCATTATCTCGCGACCAAGGAGGAGTACGACATTCAGCGGTACGAAGGGG
CCTCGACTTTGTTTGGCCGCTGGCAGCTTGACGCCTTCATGAACCTGAGTGTCAGTAGCATGCCGTATCTGGTGC
CGGGCAACCAAAATTTTCCAGAGCAAGGCACGCTGCCTCCGGATAACCGGAAAAAATCGTTCAACAGCAACAATC
CCGTCTCCCCAGACCTCAGATCGCGGACACCGGGGTATGGAGCGGTCCTGAGACAGCCTAATCCAAGATACGTCA
TCGGACAAAACGTGCAAGCCACTTTCCAAGGGGCGAATCCTCGTAACAACCTACGGTTAGAAGATACATTCGCCG
CGGTCGAGCAACTCGGCAAAGACGGGAAGTGGACGCGCGTACGCGATGATGATGACTGGTTCCTAGTATTCACAT
GGCGGAGGACAGGTAACTTCTTCAAGCGGACCGAGGAGGTCGACATAACGTGGGAAACAAAGGGAAACGCGAAGC
CGGGAATCTATCGGCTCAAGTATTACGGCGATGCGAAGACGAGATACCAGGGACTTCAGCCAATCGAGGGCACGA
GCAACAGTTTTTCGCTGACTGCCAGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail