Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6084
Gene name
LocationContig_64:23231..25128
Strand+
Gene length (bp)1897
Transcript length (bp)1782
Coding sequence length (bp)1782
Protein length (aa) 594

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 9.2E-72 38 453
PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain 7.1E-14 496 573

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 73 584 8.0E-102
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 6 581 2.0E-101
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 15 587 6.0E-100
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 55 587 4.0E-91
sp|Q6GLK6|ACSF3_XENLA Acyl-CoA synthetase family member 3, mitochondrial OS=Xenopus laevis GN=acsf3 PE=2 SV=1 79 580 3.0E-89
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 73 584 8.0E-102
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 6 581 2.0E-101
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 15 587 6.0E-100
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 55 587 4.0E-91
sp|Q6GLK6|ACSF3_XENLA Acyl-CoA synthetase family member 3, mitochondrial OS=Xenopus laevis GN=acsf3 PE=2 SV=1 79 580 3.0E-89
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 54 580 5.0E-49
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 85 584 4.0E-43
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 85 577 1.0E-38
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 34 579 3.0E-38
sp|P94547|LCFA_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 34 581 3.0E-37
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 33 579 4.0E-37
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 61 577 9.0E-37
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 85 579 4.0E-34
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 85 579 4.0E-34
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 56 579 7.0E-34
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 56 579 9.0E-34
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 56 579 2.0E-33
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 56 579 2.0E-33
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 56 579 3.0E-33
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 56 579 2.0E-32
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 56 579 2.0E-32
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 56 579 3.0E-32
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 56 579 3.0E-32
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 56 579 3.0E-32
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 56 579 4.0E-32
sp|Q5SKN9|LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 85 590 8.0E-32
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 56 579 1.0E-31
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 56 579 1.0E-31
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 56 579 1.0E-31
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 56 579 1.0E-31
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 56 579 1.0E-31
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 56 579 5.0E-31
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 45 579 5.0E-31
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 53 579 6.0E-31
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 85 579 8.0E-31
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 85 583 1.0E-30
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 84 586 2.0E-30
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 85 583 2.0E-30
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 85 583 3.0E-30
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 27 579 3.0E-30
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 87 579 4.0E-30
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 30 583 5.0E-30
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 85 583 5.0E-30
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 85 583 5.0E-30
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 30 583 5.0E-30
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 30 583 5.0E-30
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 84 581 7.0E-30
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 29 579 1.0E-29
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 30 579 2.0E-29
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 84 579 2.0E-29
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 84 579 2.0E-29
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 84 579 2.0E-29
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 85 583 2.0E-29
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 84 579 2.0E-29
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 58 579 2.0E-29
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 85 583 3.0E-29
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 84 579 5.0E-29
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 84 579 6.0E-29
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 84 579 6.0E-29
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 84 579 6.0E-29
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 84 587 7.0E-29
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 86 583 7.0E-29
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 84 579 8.0E-29
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 84 579 1.0E-28
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 84 579 1.0E-28
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 84 579 1.0E-28
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 84 579 1.0E-28
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 84 579 2.0E-28
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 84 579 3.0E-28
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 84 579 3.0E-28
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 84 579 3.0E-28
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 85 583 3.0E-28
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 84 579 4.0E-28
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 84 579 4.0E-28
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 84 579 4.0E-28
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 57 579 4.0E-28
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 84 579 5.0E-28
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 84 573 7.0E-28
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 84 579 8.0E-28
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 84 579 8.0E-28
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 84 579 1.0E-27
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 84 579 1.0E-27
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 84 579 2.0E-27
sp|B2HGV4|FAC15_MYCMM Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD15 PE=3 SV=1 84 538 2.0E-27
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 84 579 3.0E-27
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 84 579 5.0E-27
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 84 579 5.0E-27
sp|Q9FFE9|AAE6_ARATH Probable acyl-activating enzyme 6 OS=Arabidopsis thaliana GN=AAE6 PE=2 SV=1 191 576 6.0E-27
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 30 579 8.0E-27
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 45 579 2.0E-26
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 42 579 2.0E-26
sp|Q9FFE6|AAE5_ARATH Probable acyl-activating enzyme 5, peroxisomal OS=Arabidopsis thaliana GN=AAE5 PE=2 SV=1 191 576 4.0E-26
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 84 583 5.0E-26
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 84 589 5.0E-26
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 88 579 2.0E-25
sp|Q9LQS1|AAE8_ARATH Probable acyl-activating enzyme 8 OS=Arabidopsis thaliana GN=AAE8 PE=2 SV=1 191 579 2.0E-25
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 29 579 3.0E-25
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 84 579 4.0E-25
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 54 579 4.0E-25
sp|Q838K1|MENE_ENTFA 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 86 576 4.0E-25
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 84 579 5.0E-25
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 84 579 5.0E-25
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 40 579 7.0E-25
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 40 579 7.0E-25
sp|Q7TYX8|FAC15_MYCBO Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD15 PE=3 SV=2 84 538 8.0E-25
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 54 581 8.0E-25
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 53 579 1.0E-24
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 176 581 1.0E-24
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 86 584 4.0E-24
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 88 579 5.0E-24
sp|Q9C8D4|AAE11_ARATH Butyrate--CoA ligase AAE11, peroxisomal OS=Arabidopsis thaliana GN=AAE11 PE=1 SV=1 108 579 6.0E-24
sp|O53521|FAC15_MYCTU Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD15 PE=1 SV=3 84 538 1.0E-23
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 44 579 1.0E-23
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 54 579 1.0E-23
sp|Q9CHK3|MENE_LACLA 2-succinylbenzoate--CoA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menE PE=3 SV=2 87 579 2.0E-23
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 85 579 2.0E-23
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 88 579 2.0E-23
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 84 587 2.0E-23
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 84 579 2.0E-23
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 84 587 3.0E-23
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 88 579 4.0E-23
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 45 579 5.0E-23
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 87 590 5.0E-23
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 87 579 5.0E-23
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 84 579 6.0E-23
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 30 579 9.0E-23
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 29 579 9.0E-23
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 88 579 9.0E-23
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 73 579 9.0E-23
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 88 579 1.0E-22
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 88 579 1.0E-22
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 44 579 1.0E-22
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 85 581 2.0E-22
sp|Q8ENZ7|MENE_OCEIH 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 29 579 2.0E-22
sp|Q8VYJ1|MENE_ARATH 2-succinylbenzoate--CoA ligase, chloroplastic/peroxisomal OS=Arabidopsis thaliana GN=AAE14 PE=1 SV=1 54 585 2.0E-22
sp|Q00594|ALKK_PSEOL Medium-chain-fatty-acid--CoA ligase OS=Pseudomonas oleovorans GN=alkK PE=3 SV=1 87 586 2.0E-22
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 84 579 2.0E-22
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 29 579 5.0E-22
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 84 579 6.0E-22
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 85 579 6.0E-22
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 44 579 7.0E-22
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 73 579 8.0E-22
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 175 579 1.0E-21
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 54 579 1.0E-21
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 85 578 1.0E-21
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 84 583 1.0E-21
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 189 581 1.0E-21
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 84 532 2.0E-21
sp|Q9LPK6|AEE9_ARATH Probable acyl-activating enzyme 9 OS=Arabidopsis thaliana GN=AEE9 PE=2 SV=1 188 576 2.0E-21
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 168 579 3.0E-21
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 191 576 3.0E-21
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 84 581 4.0E-21
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 84 581 4.0E-21
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 27 579 5.0E-21
sp|Q9LPK7|AEE10_ARATH Probable acyl-activating enzyme 10 OS=Arabidopsis thaliana GN=AEE10 PE=2 SV=1 112 576 5.0E-21
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 88 579 5.0E-21
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 87 579 5.0E-21
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 85 579 7.0E-21
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 84 579 7.0E-21
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 85 579 1.0E-20
sp|Q9SS00|AAE12_ARATH Probable acyl-activating enzyme 12, peroxisomal OS=Arabidopsis thaliana GN=AAE12 PE=2 SV=1 191 579 1.0E-20
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 87 579 1.0E-20
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 45 581 2.0E-20
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 189 583 2.0E-20
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 34 579 2.0E-20
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 44 579 2.0E-20
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 191 579 2.0E-20
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 85 587 2.0E-20
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 84 579 3.0E-20
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 54 579 3.0E-20
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 84 579 4.0E-20
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 88 579 4.0E-20
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 40 581 5.0E-20
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 54 590 5.0E-20
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 88 579 5.0E-20
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 40 579 6.0E-20
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 94 583 7.0E-20
sp|Q9SS01|AAE20_ARATH Benzoate--CoA ligase, peroxisomal OS=Arabidopsis thaliana GN=AAE20 PE=1 SV=1 108 579 8.0E-20
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 88 579 8.0E-20
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2 579 9.0E-20
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 88 579 1.0E-19
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 85 581 1.0E-19
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 84 579 1.0E-19
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 85 579 1.0E-19
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 103 579 2.0E-19
sp|Q8VZF1|AEE7_ARATH Acetate/butyrate--CoA ligase AAE7, peroxisomal OS=Arabidopsis thaliana GN=AAE7 PE=1 SV=1 48 579 2.0E-19
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 55 588 2.0E-19
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 88 579 3.0E-19
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 186 573 3.0E-19
sp|F4HUK6|AAE1_ARATH Probable acyl-activating enzyme 1, peroxisomal OS=Arabidopsis thaliana GN=AAE1 PE=2 SV=1 191 576 4.0E-19
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 40 579 4.0E-19
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 88 584 5.0E-19
sp|Q8LKS5|LACS7_ARATH Long chain acyl-CoA synthetase 7, peroxisomal OS=Arabidopsis thaliana GN=LACS7 PE=1 SV=2 85 452 5.0E-19
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 123 579 6.0E-19
sp|Q9LQ12|4CLL1_ARATH 4-coumarate--CoA ligase-like 1 OS=Arabidopsis thaliana GN=4CLL1 PE=1 SV=1 35 579 7.0E-19
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 48 586 8.0E-19
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 84 576 9.0E-19
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 73 587 1.0E-18
sp|Q9SEY5|AAE2_ARATH Probable acyl-activating enzyme 2 OS=Arabidopsis thaliana GN=AAE2 PE=2 SV=1 108 587 1.0E-18
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 186 573 1.0E-18
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 186 573 1.0E-18
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 186 573 1.0E-18
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 186 573 1.0E-18
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 186 573 2.0E-18
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 186 573 2.0E-18
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 186 573 2.0E-18
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 186 573 2.0E-18
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 88 579 2.0E-18
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 186 573 2.0E-18
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 46 591 2.0E-18
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 46 591 2.0E-18
sp|Q8LPS1|LACS6_ARATH Long chain acyl-CoA synthetase 6, peroxisomal OS=Arabidopsis thaliana GN=LACS6 PE=1 SV=1 167 452 2.0E-18
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 85 579 2.0E-18
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 34 579 3.0E-18
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 88 579 4.0E-18
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 186 573 5.0E-18
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 43 579 6.0E-18
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 54 579 7.0E-18
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 18 513 7.0E-18
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 85 579 7.0E-18
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 186 450 7.0E-18
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 88 579 8.0E-18
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 97 585 9.0E-18
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 34 579 1.0E-17
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 34 579 1.0E-17
sp|Q91VA0|ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus GN=Acsm1 PE=1 SV=1 84 585 2.0E-17
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 23 579 2.0E-17
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 88 590 4.0E-17
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 34 579 4.0E-17
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 58 528 4.0E-17
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 186 499 4.0E-17
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 85 579 5.0E-17
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 84 581 5.0E-17
sp|Q9XIA9|LACS2_ARATH Long chain acyl-CoA synthetase 2 OS=Arabidopsis thaliana GN=LACS2 PE=2 SV=1 73 544 5.0E-17
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 186 499 6.0E-17
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 58 528 6.0E-17
sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 191 579 7.0E-17
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 97 585 7.0E-17
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 85 579 8.0E-17
sp|P9WQ61|FAA22_MYCTU p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD22 PE=1 SV=1 84 579 8.0E-17
sp|P9WQ60|FAA22_MYCTO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD22 PE=3 SV=1 84 579 8.0E-17
sp|Q7TXK7|FAA22_MYCBO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD22 PE=1 SV=1 84 579 8.0E-17
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 97 585 8.0E-17
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 85 579 9.0E-17
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 74 582 1.0E-16
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 97 585 1.0E-16
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 97 585 1.0E-16
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 97 585 1.0E-16
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 97 585 1.0E-16
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 97 585 1.0E-16
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 40 581 1.0E-16
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 97 585 2.0E-16
sp|Q9QUJ7|ACSL4_MOUSE Long-chain-fatty-acid--CoA ligase 4 OS=Mus musculus GN=Acsl4 PE=1 SV=2 96 451 2.0E-16
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 97 585 2.0E-16
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 58 528 2.0E-16
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 97 585 3.0E-16
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 97 585 3.0E-16
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 97 585 3.0E-16
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 97 585 3.0E-16
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 97 585 3.0E-16
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 97 585 3.0E-16
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 192 579 3.0E-16
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 40 576 4.0E-16
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 40 576 4.0E-16
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 186 450 4.0E-16
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 50 591 4.0E-16
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 97 580 5.0E-16
sp|O35547|ACSL4_RAT Long-chain-fatty-acid--CoA ligase 4 OS=Rattus norvegicus GN=Acsl4 PE=1 SV=1 96 451 5.0E-16
sp|O60488|ACSL4_HUMAN Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens GN=ACSL4 PE=1 SV=2 96 451 6.0E-16
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 192 579 7.0E-16
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 45 581 9.0E-16
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 191 579 9.0E-16
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 73 579 1.0E-15
sp|P47912|LCF4_YEAST Long-chain-fatty-acid--CoA ligase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA4 PE=1 SV=1 163 451 1.0E-15
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 351 593 1.0E-15
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 84 579 1.0E-15
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 99 579 1.0E-15
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 85 579 2.0E-15
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 34 579 2.0E-15
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 99 579 2.0E-15
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 7 579 2.0E-15
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 85 591 2.0E-15
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 87 581 3.0E-15
sp|P9WQ43|FAA26_MYCTU Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD26 PE=1 SV=1 31 588 3.0E-15
sp|P9WQ42|FAA26_MYCTO Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD26 PE=3 SV=1 31 588 3.0E-15
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 99 579 3.0E-15
sp|Q7TXM1|FAA26_MYCBO Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD26 PE=1 SV=1 31 588 4.0E-15
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 36 579 4.0E-15
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 22 579 5.0E-15
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 88 579 5.0E-15
sp|P9WQD1|ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acsA PE=1 SV=1 50 591 5.0E-15
sp|P9WQD0|ACSA_MYCTO Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=acsA PE=3 SV=1 50 591 5.0E-15
sp|P59871|ACSA_MYCBO Acetyl-coenzyme A synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=acsA PE=3 SV=1 50 591 5.0E-15
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 54 579 5.0E-15
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 185 450 6.0E-15
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 88 579 7.0E-15
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 40 579 1.0E-14
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 88 579 1.0E-14
sp|E3UUE6|FAC19_RHORH 3-oxocholest-4-en-26-oate--CoA ligase OS=Rhodococcus rhodochrous GN=fadD19 PE=1 SV=1 54 573 1.0E-14
sp|P9WQ47|FAC23_MYCTU Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD23 PE=1 SV=1 29 589 1.0E-14
sp|P9WQ46|FAC23_MYCTO Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD23 PE=3 SV=1 29 589 1.0E-14
sp|Q7TVK7|FAC23_MYCBO Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD23 PE=3 SV=1 29 589 1.0E-14
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 44 579 2.0E-14
sp|P41216|ACSL1_MOUSE Long-chain-fatty-acid--CoA ligase 1 OS=Mus musculus GN=Acsl1 PE=1 SV=2 84 451 2.0E-14
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 45 589 2.0E-14
sp|Q9C9G2|AEE22_ARATH Probable acyl-activating enzyme 22 OS=Arabidopsis thaliana GN=AEE22 PE=3 SV=1 108 592 2.0E-14
sp|Q55DR6|FCSA_DICDI Fatty acyl-CoA synthetase A OS=Dictyostelium discoideum GN=fcsA PE=1 SV=1 85 451 2.0E-14
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 189 583 2.0E-14
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 189 583 2.0E-14
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 189 583 2.0E-14
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 189 583 2.0E-14
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 189 583 2.0E-14
sp|Q9T009|LACS5_ARATH Long chain acyl-CoA synthetase 5 OS=Arabidopsis thaliana GN=LACS5 PE=2 SV=1 59 451 2.0E-14
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 73 579 3.0E-14
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 74 579 3.0E-14
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 41 591 3.0E-14
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 94 529 3.0E-14
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 35 579 3.0E-14
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 189 583 3.0E-14
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 189 583 4.0E-14
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 189 583 4.0E-14
sp|Q9P7D7|LCF2_SCHPO Long-chain-fatty-acid--CoA ligase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcf2 PE=3 SV=1 181 514 4.0E-14
sp|Q8W471|AAE15_ARATH Long-chain-fatty-acid--[acyl-carrier-protein] ligase AEE15, chloroplastic OS=Arabidopsis thaliana GN=AAE15 PE=1 SV=1 16 548 4.0E-14
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 189 583 4.0E-14
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 189 583 4.0E-14
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 189 583 4.0E-14
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 44 585 5.0E-14
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 85 579 5.0E-14
sp|Q9CMW1|ACSA_PASMU Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 58 587 5.0E-14
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 181 450 6.0E-14
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 99 579 6.0E-14
sp|Q9C7W4|LACS3_ARATH Long chain acyl-CoA synthetase 3 OS=Arabidopsis thaliana GN=LACS3 PE=2 SV=1 59 451 7.0E-14
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 44 579 8.0E-14
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 35 579 1.0E-13
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 85 579 1.0E-13
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 56 591 1.0E-13
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 85 579 1.0E-13
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 34 579 1.0E-13
sp|B2HHZ8|FAC17_MYCMM Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD17 PE=3 SV=1 88 579 1.0E-13
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 88 579 2.0E-13
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 99 579 2.0E-13
sp|A5JTM6|CBACL_PSEUC 4-chlorobenzoate--CoA ligase OS=Pseudomonas sp. (strain CBS-3) PE=1 SV=1 185 585 2.0E-13
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 186 450 2.0E-13
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 84 579 3.0E-13
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 186 450 3.0E-13
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 186 450 3.0E-13
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 186 450 3.0E-13
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 186 450 3.0E-13
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 186 450 3.0E-13
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 186 450 3.0E-13
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 186 450 3.0E-13
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 186 450 3.0E-13
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 186 450 3.0E-13
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 186 450 3.0E-13
sp|Q02278|FAA28_MYCBO Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD28 PE=3 SV=2 31 589 4.0E-13
sp|B2HIM0|FAA28_MYCMM Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD28 PE=3 SV=1 31 589 4.0E-13
sp|B2HIL6|FAA22_MYCMM p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD22 PE=1 SV=1 85 579 4.0E-13
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 187 450 4.0E-13
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 187 450 4.0E-13
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 187 450 4.0E-13
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 187 450 4.0E-13
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 54 579 5.0E-13
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 187 450 5.0E-13
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 187 450 5.0E-13
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 187 450 5.0E-13
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 187 450 5.0E-13
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 181 450 5.0E-13
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 187 450 5.0E-13
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 187 450 5.0E-13
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 187 450 5.0E-13
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 187 450 5.0E-13
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 187 450 5.0E-13
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 187 450 5.0E-13
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 85 579 5.0E-13
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 187 450 5.0E-13
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 187 450 5.0E-13
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 187 450 5.0E-13
sp|P9WQ59|FAA28_MYCTU Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD28 PE=1 SV=1 31 589 5.0E-13
sp|P9WQ58|FAA28_MYCTO Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD28 PE=3 SV=1 31 589 5.0E-13
sp|P19409|BAIB_CLOSV Bile acid-coenzyme A ligase OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiB PE=1 SV=1 85 585 5.0E-13
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 187 450 5.0E-13
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 88 579 6.0E-13
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 22 582 6.0E-13
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 96 583 6.0E-13
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 187 450 6.0E-13
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 187 450 6.0E-13
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 56 581 6.0E-13
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 187 450 6.0E-13
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 187 450 6.0E-13
sp|P27095|ACSA_METCN Acetyl-coenzyme A synthetase OS=Methanosaeta concilii GN=acsA PE=1 SV=1 173 577 6.0E-13
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 187 450 7.0E-13
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 187 450 7.0E-13
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 85 580 7.0E-13
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 40 579 8.0E-13
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 187 450 8.0E-13
sp|Q46Z41|ACSA_CUPPJ Acetyl-coenzyme A synthetase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=acsA PE=3 SV=1 84 591 8.0E-13
sp|P54200|FAD21_MYCLE Putative fatty-acid--CoA ligase fadD21 OS=Mycobacterium leprae (strain TN) GN=fadD21 PE=3 SV=2 56 452 8.0E-13
sp|O95573|ACSL3_HUMAN Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens GN=ACSL3 PE=1 SV=3 56 549 9.0E-13
sp|Q5R668|ACSL3_PONAB Long-chain-fatty-acid--CoA ligase 3 OS=Pongo abelii GN=ACSL3 PE=2 SV=2 56 549 9.0E-13
sp|A7MPJ7|ACSA_CROS8 Acetyl-coenzyme A synthetase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=acs PE=3 SV=1 188 586 1.0E-12
sp|P97849|S27A1_RAT Long-chain fatty acid transport protein 1 OS=Rattus norvegicus GN=Slc27a1 PE=2 SV=1 28 584 1.0E-12
sp|O60135|LCF1_SCHPO Long-chain-fatty-acid--CoA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcf1 PE=3 SV=1 187 451 1.0E-12
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 88 579 1.0E-12
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 34 579 1.0E-12
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 99 583 1.0E-12
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 34 579 1.0E-12
sp|O70490|ACSM2_RAT Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Rattus norvegicus GN=Acsm2 PE=2 SV=2 85 579 1.0E-12
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 40 579 2.0E-12
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 186 450 2.0E-12
sp|A8AN29|ACSA_CITK8 Acetyl-coenzyme A synthetase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=acs PE=3 SV=1 188 586 2.0E-12
sp|Q3SLF4|ACSA_THIDA Acetyl-coenzyme A synthetase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=acsA PE=3 SV=1 56 587 2.0E-12
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 11 587 2.0E-12
sp|P59872|ACSA_RHOBA Acetyl-coenzyme A synthetase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acsA PE=3 SV=1 56 591 2.0E-12
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 97 579 2.0E-12
sp|A4TS06|ACSA_YERPP Acetyl-coenzyme A synthetase OS=Yersinia pestis (strain Pestoides F) GN=acs PE=3 SV=1 163 586 2.0E-12
sp|Q1CE37|ACSA_YERPN Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=acs PE=3 SV=1 163 586 2.0E-12
sp|Q8D1G8|ACSA_YERPE Acetyl-coenzyme A synthetase OS=Yersinia pestis GN=acs PE=3 SV=2 163 586 2.0E-12
sp|Q1C0N0|ACSA_YERPA Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=acs PE=3 SV=1 163 586 2.0E-12
sp|B2HIN2|FAA26_MYCMM Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD26 PE=3 SV=1 31 589 2.0E-12
sp|P9WQ49|FAD21_MYCTU Putative fatty-acid--CoA ligase FadD21 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD21 PE=1 SV=1 84 452 3.0E-12
sp|P9WQ48|FAD21_MYCTO Putative fatty-acid--CoA ligase fadD21 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD21 PE=3 SV=1 84 452 3.0E-12
sp|P63524|FAD21_MYCBO Putative fatty-acid--CoA ligase fadD21 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD21 PE=3 SV=1 84 452 3.0E-12
sp|Q66FM8|ACSA_YERPS Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=acs PE=3 SV=1 163 586 3.0E-12
sp|A7FNG1|ACSA_YERP3 Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=acs PE=3 SV=1 163 586 3.0E-12
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 55 579 4.0E-12
sp|P78773|ACSA_SCHPO Probable acetyl-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC191.02c PE=1 SV=2 54 587 4.0E-12
sp|A1JIK3|ACSA_YERE8 Acetyl-coenzyme A synthetase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=acs PE=3 SV=1 188 586 4.0E-12
sp|O93730|ACSA_PYRAE Acetyl-coenzyme A synthetase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=acsA PE=3 SV=2 56 583 4.0E-12
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 40 579 5.0E-12
sp|P31638|ACSA_CUPNH Acetyl-coenzyme A synthetase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=acsA PE=3 SV=1 59 591 5.0E-12
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 53 450 5.0E-12
sp|B2JD61|ACSA_BURP8 Acetyl-coenzyme A synthetase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=acsA PE=3 SV=1 185 591 6.0E-12
sp|Q6PCB7|S27A1_HUMAN Long-chain fatty acid transport protein 1 OS=Homo sapiens GN=SLC27A1 PE=2 SV=1 28 584 7.0E-12
sp|Q1LL27|ACSA_CUPMC Acetyl-coenzyme A synthetase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=acsA PE=3 SV=1 59 587 7.0E-12
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 56 579 9.0E-12
sp|Q55404|ACSA_SYNY3 Acetyl-coenzyme A synthetase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=acsA PE=3 SV=1 56 591 9.0E-12
sp|B3R1X2|ACSA_CUPTR Acetyl-coenzyme A synthetase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=acsA PE=3 SV=1 59 591 2.0E-11
sp|Q9LK39|AAE16_ARATH Probable acyl-activating enzyme 16, chloroplastic OS=Arabidopsis thaliana GN=AAE16 PE=2 SV=1 282 536 2.0E-11
sp|Q8X5T5|ACSA_ECO57 Acetyl-coenzyme A synthetase OS=Escherichia coli O157:H7 GN=acs PE=3 SV=1 166 586 2.0E-11
sp|Q8ZKF6|ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acs PE=1 SV=1 188 586 2.0E-11
sp|Q8XY11|ACSA_RALSO Acetyl-coenzyme A synthetase OS=Ralstonia solanacearum (strain GMI1000) GN=acsA PE=3 SV=1 58 587 2.0E-11
sp|Q8Z1R0|ACSA_SALTI Acetyl-coenzyme A synthetase OS=Salmonella typhi GN=acs PE=3 SV=1 188 586 2.0E-11
sp|B2U6V1|ACSA_RALPJ Acetyl-coenzyme A synthetase OS=Ralstonia pickettii (strain 12J) GN=acsA PE=3 SV=1 59 591 2.0E-11
sp|Q2YTP0|MENE_STAAB 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menE PE=3 SV=1 56 582 2.0E-11
sp|B0SRX5|ACSA_LEPBP Acetyl-coenzyme A synthetase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=acsA PE=3 SV=1 161 588 3.0E-11
sp|B0S8X7|ACSA_LEPBA Acetyl-coenzyme A synthetase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=acsA PE=3 SV=1 161 588 3.0E-11
sp|P9WQ45|FAD25_MYCTU Putative fatty-acid--CoA ligase fadD25 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD25 PE=1 SV=1 30 589 3.0E-11
sp|P9WQ44|FAD25_MYCTO Putative fatty-acid--CoA ligase fadD25 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD25 PE=3 SV=1 30 589 3.0E-11
sp|P16929|ACSA_NEUCR Acetyl-coenzyme A synthetase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-5 PE=2 SV=2 40 587 3.0E-11
sp|Q8FAY8|ACSA_ECOL6 Acetyl-coenzyme A synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=acs PE=3 SV=1 188 586 3.0E-11
sp|Q8DCZ9|ACSA_VIBVU Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain CMCP6) GN=acsA PE=3 SV=1 56 586 3.0E-11
sp|A4G3L8|ACSA_HERAR Acetyl-coenzyme A synthetase OS=Herminiimonas arsenicoxydans GN=acsA PE=3 SV=1 185 587 3.0E-11
sp|Q7MBA6|ACSA_PHOLL Acetyl-coenzyme A synthetase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=acs PE=3 SV=1 170 586 3.0E-11
sp|Q7MGU3|ACSA_VIBVY Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain YJ016) GN=acsA PE=3 SV=2 56 586 3.0E-11
sp|Q39EK2|ACSA_BURL3 Acetyl-coenzyme A synthetase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=acsA PE=3 SV=1 59 587 3.0E-11
sp|P27550|ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) GN=acs PE=1 SV=2 188 586 4.0E-11
sp|Q7TXK5|FAA29_MYCBO Long-chain-fatty-acid--AMP ligase FadD29 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD29 PE=3 SV=1 84 589 4.0E-11
sp|P95141|FAA29_MYCTU Long-chain-fatty-acid--AMP ligase FadD29 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD29 PE=1 SV=1 84 589 4.0E-11
sp|P36333|ACSA_PENCH Acetyl-coenzyme A synthetase OS=Penicillium chrysogenum GN=facA PE=3 SV=1 54 589 5.0E-11
sp|Q6FLU2|ACS1_CANGA Acetyl-coenzyme A synthetase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS1 PE=3 SV=1 44 587 5.0E-11
sp|Q5HNB2|MENE_STAEQ 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menE PE=3 SV=1 83 579 6.0E-11
sp|P63526|MENE_STAAN 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain N315) GN=menE PE=1 SV=1 189 582 7.0E-11
sp|P63525|MENE_STAAM 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menE PE=3 SV=1 189 582 7.0E-11
sp|A5ITW2|MENE_STAA9 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH9) GN=menE PE=3 SV=1 189 582 7.0E-11
sp|A6U2Q7|MENE_STAA2 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH1) GN=menE PE=3 SV=1 189 582 7.0E-11
sp|A7X3P0|MENE_STAA1 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menE PE=3 SV=1 189 582 7.0E-11
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 88 581 7.0E-11
sp|Q53634|MENE_STAAU 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus GN=menE PE=3 SV=1 189 582 7.0E-11
sp|A8Z4L9|MENE_STAAT 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menE PE=3 SV=1 189 582 7.0E-11
sp|A6QHX6|MENE_STAAE 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Newman) GN=menE PE=3 SV=1 189 582 7.0E-11
sp|Q5HEY2|MENE_STAAC 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain COL) GN=menE PE=3 SV=1 189 582 7.0E-11
sp|Q2G2V3|MENE_STAA8 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=menE PE=3 SV=1 189 582 7.0E-11
sp|Q2FFU9|MENE_STAA3 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300) GN=menE PE=3 SV=1 189 582 7.0E-11
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 364 579 8.0E-11
sp|O53551|FAC17_MYCTU Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD17 PE=1 SV=1 71 579 8.0E-11
sp|Q7TWC5|FAC17_MYCBO Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD17 PE=3 SV=1 71 579 8.0E-11
sp|Q8NVZ4|MENE_STAAW 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MW2) GN=menE PE=3 SV=1 56 582 8.0E-11
sp|Q6G8D6|MENE_STAAS 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MSSA476) GN=menE PE=3 SV=1 56 582 8.0E-11
sp|Q9RRL7|ACSA_DEIRA Acetyl-coenzyme A synthetase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=acsA PE=3 SV=1 56 591 8.0E-11
sp|Q91VE0|S27A4_MOUSE Long-chain fatty acid transport protein 4 OS=Mus musculus GN=Slc27a4 PE=1 SV=1 33 584 9.0E-11
sp|Q2T3N9|ACSA_BURTA Acetyl-coenzyme A synthetase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=acsA PE=3 SV=1 59 579 1.0E-10
sp|A9W5V0|ACSA_METEP Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain PA1) GN=acsA PE=3 SV=1 56 589 1.0E-10
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 336 579 2.0E-10
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 40 513 2.0E-10
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 189 579 2.0E-10
sp|P9WQ51|FAC19_MYCTU Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD19 PE=1 SV=1 87 573 2.0E-10
sp|P9WQ50|FAC19_MYCTO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD19 PE=3 SV=1 87 573 2.0E-10
sp|Q7TWB7|FAC19_MYCBO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD19 PE=3 SV=1 87 573 2.0E-10
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 88 579 2.0E-10
sp|B2HI05|FAC19_MYCMM Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD19 PE=3 SV=1 84 573 2.0E-10
sp|P31686|4CL1_SOYBN 4-coumarate--CoA ligase 1 (Fragment) OS=Glycine max PE=2 SV=1 288 579 2.0E-10
sp|Q8EYG2|ACSA_LEPIN Acetyl-coenzyme A synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=acsA PE=3 SV=1 56 590 2.0E-10
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 88 579 2.0E-10
sp|Q72LY9|ACSA_LEPIC Acetyl-coenzyme A synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=acsA PE=3 SV=1 56 590 3.0E-10
sp|A8G8G7|ACSA_SERP5 Acetyl-coenzyme A synthetase OS=Serratia proteamaculans (strain 568) GN=acs PE=3 SV=1 188 586 3.0E-10
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 88 450 3.0E-10
sp|Q9CZW4|ACSL3_MOUSE Long-chain-fatty-acid--CoA ligase 3 OS=Mus musculus GN=Acsl3 PE=1 SV=2 88 451 3.0E-10
sp|A0B8F1|ACSA_METTP Acetyl-coenzyme A synthetase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=acsA PE=1 SV=1 56 577 3.0E-10
sp|B7KPN8|ACSA_METC4 Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=acsA PE=3 SV=1 56 589 4.0E-10
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 189 583 4.0E-10
sp|Q9UKU0|ACSL6_HUMAN Long-chain-fatty-acid--CoA ligase 6 OS=Homo sapiens GN=ACSL6 PE=2 SV=4 181 451 4.0E-10
sp|Q63NC4|ACSA_BURPS Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain K96243) GN=acsA PE=3 SV=1 59 579 5.0E-10
sp|A3NH07|ACSA_BURP6 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 668) GN=acsA PE=3 SV=1 59 579 5.0E-10
sp|Q3JH62|ACSA_BURP1 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1710b) GN=acsA PE=3 SV=1 59 579 5.0E-10
sp|A3P2K7|ACSA_BURP0 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1106a) GN=acsA PE=3 SV=1 59 579 5.0E-10
sp|A1UWN5|ACSA_BURMS Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain SAVP1) GN=acsA PE=3 SV=1 59 579 5.0E-10
sp|Q62AD1|ACSA_BURMA Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain ATCC 23344) GN=acsA PE=3 SV=1 59 579 5.0E-10
sp|A2RYW5|ACSA_BURM9 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10229) GN=acsA PE=3 SV=1 59 579 5.0E-10
sp|A3MG40|ACSA_BURM7 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10247) GN=acsA PE=3 SV=1 59 579 5.0E-10
sp|Q9SJD4|LACS8_ARATH Long chain acyl-CoA synthetase 8 OS=Arabidopsis thaliana GN=LACS8 PE=1 SV=1 87 589 5.0E-10
sp|Q89WV5|ACSA_BRADU Acetyl-coenzyme A synthetase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=acsA PE=1 SV=2 56 587 5.0E-10
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 373 591 6.0E-10
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 373 591 6.0E-10
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 35 514 6.0E-10
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 373 591 7.0E-10
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 347 579 7.0E-10
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 358 583 7.0E-10
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 358 583 8.0E-10
sp|B1M0M1|ACSA_METRJ Acetyl-coenzyme A synthetase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=acsA PE=3 SV=1 56 589 8.0E-10
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 88 581 1.0E-09
sp|Q758X0|ACS1_ASHGO Acetyl-coenzyme A synthetase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS1 PE=3 SV=1 55 587 1.0E-09
sp|Q2NR28|ACSA_SODGM Acetyl-coenzyme A synthetase OS=Sodalis glossinidius (strain morsitans) GN=acs PE=3 SV=1 188 586 1.0E-09
sp|P52910|ACS2_YEAST Acetyl-coenzyme A synthetase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS2 PE=1 SV=1 188 587 1.0E-09
sp|Q9KV59|ACSA_VIBCH Acetyl-coenzyme A synthetase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=acsA PE=3 SV=2 56 586 1.0E-09
sp|Q1H0J2|ACSA_METFK Acetyl-coenzyme A synthetase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=acsA PE=3 SV=1 58 591 1.0E-09
sp|Q3ZKN0|S27A1_BOVIN Long-chain fatty acid transport protein 1 OS=Bos taurus GN=SLC27A1 PE=2 SV=1 28 584 1.0E-09
sp|Q6GFR0|MENE_STAAR 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MRSA252) GN=menE PE=3 SV=1 189 582 1.0E-09
sp|Q07VK4|ACSA_RHOP5 Acetyl-coenzyme A synthetase OS=Rhodopseudomonas palustris (strain BisA53) GN=acsA PE=3 SV=1 170 589 1.0E-09
sp|A0LG91|ACSA_SYNFM Acetyl-coenzyme A synthetase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=acsA PE=3 SV=1 56 589 2.0E-09
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 40 583 2.0E-09
sp|Q96VC7|ACS2_ZYGBA Acetyl-coenzyme A synthetase 2 OS=Zygosaccharomyces bailii GN=ACS2 PE=3 SV=1 188 587 2.0E-09
sp|A7IFD4|ACSA_XANP2 Acetyl-coenzyme A synthetase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=acsA PE=3 SV=1 170 589 2.0E-09
sp|Q0AFF1|ACSA_NITEC Acetyl-coenzyme A synthetase OS=Nitrosomonas eutropha (strain C91) GN=acsA PE=3 SV=1 84 579 2.0E-09
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 56 579 3.0E-09
sp|A0KNI2|ACSA_AERHH Acetyl-coenzyme A synthetase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=acsA PE=3 SV=1 188 579 3.0E-09
sp|P16928|ACSA_EMENI Acetyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=facA PE=2 SV=2 54 589 3.0E-09
sp|Q01574|ACS1_YEAST Acetyl-coenzyme A synthetase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS1 PE=1 SV=2 55 587 3.0E-09
sp|Q4R3Y4|S27A4_MACFA Long-chain fatty acid transport protein 4 OS=Macaca fascicularis GN=SLC27A4 PE=2 SV=2 33 584 3.0E-09
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 88 579 2.0E-08
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 88 579 2.0E-08
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 44 579 2.0E-08
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 354 579 6.0E-08
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 354 579 6.0E-08
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 337 579 7.0E-08
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 409 579 2.0E-07
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 410 593 2.0E-07
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 353 579 5.0E-07
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 85 583 6.0E-07
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 58 209 8.0E-07
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 59 226 5.0E-06
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 358 589 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6084
MLARCLTLRRVLGARMASSSVSSASASASSSSPSILRAVAQHDPASTAVLHWPSGRAFTYGHLLVDVVRTRDRLR
GAAPGRDISGRRVAFLLENGYDFVVTLLASLAAGSVAVPLSAAFPAPELQYILNHSEASLLVTSAKLAAKADELL
ATELASKPVRLRLDKHLEGEAPSKPVSIDEPHVAHASLMLYTSGTTSRPKGVVLPHSVLEAQSRSLIEAWRYTPS
DRLLHVLPLNHIHGVVNALITPLVAGSSVEFMFPFNANAVWNRLAAPFTSVDDDNSSSSKRPHPITLFTVVPTVY
SRLMASHASLPRHVADAARTAISPANMRLAISGSAALPTPVKTAWRDLSGGNVLLERYGMTEVGMALSCGLDPAD
RVDASVGWPLPSVQLRLVDLDSGRVIADDALDQPGEIHLRGPTVFSQYWNNPDATANAFVDDPNGGQPWFRTGDV
ALRRAVATAGLNPTQRDWARGPVFFVQGRVSADIIKTGGEKVSALEVERELLSLPEVAEAAVVAVPSGNWGQKVG
AVVVLDQQVAHKWTPLEMRRALKGRLAAFKIPQALKVVPQIPRNAMGKVNKKELVRAVFADEFSGDEK*
Coding >Ophun1|6084
ATGCTGGCCCGCTGCCTGACCCTCCGGCGCGTCCTCGGCGCCAGAATGGCCTCCTCGTCCGTCTCCTCCGCCTCC
GCCTCCGCCTCCTCCTCCTCCCCTTCCATCCTCCGAGCCGTCGCCCAGCACGATCCCGCCTCTACCGCCGTCCTG
CACTGGCCCTCGGGCCGCGCCTTTACCTACGGCCATCTGCTCGTCGATGTTGTCCGCACCCGGGACCGGCTACGA
GGCGCGGCGCCCGGACGGGACATCTCGGGCCGTCGGGTTGCTTTCCTGCTGGAGAACGGCTACGACTTTGTCGTG
ACGCTACTGGCTTCTCTGGCCGCCGGCTCCGTGGCCGTGCCCCTGTCAGCCGCCTTTCCGGCCCCCGAGCTGCAG
TACATCCTCAACCACAGCGAGGCCTCTCTGCTCGTCACCTCGGCCAAGCTCGCTGCCAAGGCTGACGAGCTGCTG
GCCACGGAGTTGGCGTCCAAGCCCGTCCGTCTGCGGCTGGACAAGCACCTTGAAGGCGAAGCGCCGTCGAAGCCC
GTATCCATCGACGAGCCCCATGTCGCCCATGCCAGTCTCATGCTATACACGTCCGGGACGACGAGCCGTCCGAAG
GGCGTCGTCCTGCCACACTCGGTCCTCGAGGCCCAATCCCGGTCCCTCATCGAGGCCTGGCGCTACACCCCCTCA
GACCGCCTCCTCCATGTCCTGCCTCTGAACCACATCCACGGCGTGGTCAACGCCCTCATCACGCCCCTCGTTGCC
GGCTCCTCGGTCGAGTTCATGTTTCCCTTTAACGCTAATGCCGTATGGAACCGGCTGGCGGCGCCCTTTACCTCG
GTTGATGACGACAACAGCAGCAGCAGCAAAAGACCGCATCCAATCACCCTCTTCACCGTCGTGCCCACCGTCTAC
AGCCGTCTGATGGCCTCACACGCATCCCTCCCTCGCCACGTGGCCGACGCCGCCCGCACCGCCATCTCACCCGCC
AACATGCGGCTCGCCATCTCCGGTTCGGCCGCTCTGCCAACCCCCGTAAAGACGGCATGGCGCGACCTGAGCGGC
GGAAACGTCCTACTCGAGCGCTACGGCATGACCGAAGTCGGCATGGCCCTCAGCTGCGGCCTCGATCCGGCAGAT
CGGGTCGACGCCAGCGTTGGATGGCCGCTGCCTTCGGTCCAGCTCCGTCTCGTCGACCTCGACTCCGGTCGTGTC
ATCGCCGACGACGCCCTCGATCAGCCCGGCGAGATTCACTTGCGCGGCCCAACCGTCTTCAGCCAGTACTGGAAC
AACCCAGACGCCACGGCCAACGCCTTCGTCGATGACCCGAACGGCGGCCAGCCCTGGTTCCGCACCGGCGACGTC
GCCCTCCGTCGCGCCGTGGCGACAGCTGGCCTCAACCCGACGCAGCGAGATTGGGCGCGCGGCCCCGTCTTCTTC
GTCCAGGGCCGCGTCAGCGCCGACATCATCAAGACGGGCGGCGAAAAGGTCAGCGCCCTCGAGGTCGAGCGCGAG
CTGCTCTCCCTACCCGAGGTAGCCGAGGCCGCCGTCGTGGCTGTGCCGAGCGGTAACTGGGGGCAAAAGGTGGGC
GCTGTCGTCGTCCTTGACCAGCAGGTGGCGCACAAGTGGACGCCGCTCGAGATGCGCCGCGCTCTCAAGGGTCGC
CTCGCTGCCTTTAAGATCCCTCAGGCTCTCAAGGTCGTACCGCAGATCCCTCGCAACGCCATGGGCAAGGTCAAC
AAAAAGGAGCTCGTTCGCGCCGTCTTCGCCGACGAGTTTAGCGGTGATGAGAAGTAA
Transcript >Ophun1|6084
ATGCTGGCCCGCTGCCTGACCCTCCGGCGCGTCCTCGGCGCCAGAATGGCCTCCTCGTCCGTCTCCTCCGCCTCC
GCCTCCGCCTCCTCCTCCTCCCCTTCCATCCTCCGAGCCGTCGCCCAGCACGATCCCGCCTCTACCGCCGTCCTG
CACTGGCCCTCGGGCCGCGCCTTTACCTACGGCCATCTGCTCGTCGATGTTGTCCGCACCCGGGACCGGCTACGA
GGCGCGGCGCCCGGACGGGACATCTCGGGCCGTCGGGTTGCTTTCCTGCTGGAGAACGGCTACGACTTTGTCGTG
ACGCTACTGGCTTCTCTGGCCGCCGGCTCCGTGGCCGTGCCCCTGTCAGCCGCCTTTCCGGCCCCCGAGCTGCAG
TACATCCTCAACCACAGCGAGGCCTCTCTGCTCGTCACCTCGGCCAAGCTCGCTGCCAAGGCTGACGAGCTGCTG
GCCACGGAGTTGGCGTCCAAGCCCGTCCGTCTGCGGCTGGACAAGCACCTTGAAGGCGAAGCGCCGTCGAAGCCC
GTATCCATCGACGAGCCCCATGTCGCCCATGCCAGTCTCATGCTATACACGTCCGGGACGACGAGCCGTCCGAAG
GGCGTCGTCCTGCCACACTCGGTCCTCGAGGCCCAATCCCGGTCCCTCATCGAGGCCTGGCGCTACACCCCCTCA
GACCGCCTCCTCCATGTCCTGCCTCTGAACCACATCCACGGCGTGGTCAACGCCCTCATCACGCCCCTCGTTGCC
GGCTCCTCGGTCGAGTTCATGTTTCCCTTTAACGCTAATGCCGTATGGAACCGGCTGGCGGCGCCCTTTACCTCG
GTTGATGACGACAACAGCAGCAGCAGCAAAAGACCGCATCCAATCACCCTCTTCACCGTCGTGCCCACCGTCTAC
AGCCGTCTGATGGCCTCACACGCATCCCTCCCTCGCCACGTGGCCGACGCCGCCCGCACCGCCATCTCACCCGCC
AACATGCGGCTCGCCATCTCCGGTTCGGCCGCTCTGCCAACCCCCGTAAAGACGGCATGGCGCGACCTGAGCGGC
GGAAACGTCCTACTCGAGCGCTACGGCATGACCGAAGTCGGCATGGCCCTCAGCTGCGGCCTCGATCCGGCAGAT
CGGGTCGACGCCAGCGTTGGATGGCCGCTGCCTTCGGTCCAGCTCCGTCTCGTCGACCTCGACTCCGGTCGTGTC
ATCGCCGACGACGCCCTCGATCAGCCCGGCGAGATTCACTTGCGCGGCCCAACCGTCTTCAGCCAGTACTGGAAC
AACCCAGACGCCACGGCCAACGCCTTCGTCGATGACCCGAACGGCGGCCAGCCCTGGTTCCGCACCGGCGACGTC
GCCCTCCGTCGCGCCGTGGCGACAGCTGGCCTCAACCCGACGCAGCGAGATTGGGCGCGCGGCCCCGTCTTCTTC
GTCCAGGGCCGCGTCAGCGCCGACATCATCAAGACGGGCGGCGAAAAGGTCAGCGCCCTCGAGGTCGAGCGCGAG
CTGCTCTCCCTACCCGAGGTAGCCGAGGCCGCCGTCGTGGCTGTGCCGAGCGGTAACTGGGGGCAAAAGGTGGGC
GCTGTCGTCGTCCTTGACCAGCAGGTGGCGCACAAGTGGACGCCGCTCGAGATGCGCCGCGCTCTCAAGGGTCGC
CTCGCTGCCTTTAAGATCCCTCAGGCTCTCAAGGTCGTACCGCAGATCCCTCGCAACGCCATGGGCAAGGTCAAC
AAAAAGGAGCTCGTTCGCGCCGTCTTCGCCGACGAGTTTAGCGGTGATGAGAAGTAA
Gene >Ophun1|6084
ATGCTGGCCCGCTGCCTGACCCTCCGGCGCGTCCTCGGCGCCAGAATGGCCTCCTCGTCCGTCTCCTCCGCCTCC
GCCTCCGCCTCCTCCTCCTCCCCTTCCATCCTCCGAGCCGTCGCCCAGCACGATCCCGCCTCTACCGCCGTCCTG
CACTGGCCCTCGGGCCGCGCCTTTACCTACGGCCATCTGCTCGTCGATGTTGTCCGCACCCGGGACCGGCTACGA
GGCGCGGCGCCCGGACGGGACATCTCGGGCCGTCGGGTTGCTTTCCTGCTGGAGAACGGCTACGACTTTGTCGGT
ACGTACGCCGCACCTCTTGCACATCTCTCTGCCCAGGCTGACTGACGGCTCTCGTCCAGTGACGCTACTGGCTTC
TCTGGCCGCCGGCTCCGTGGCCGTGCCCCTGTCAGCCGCCTTTCCGGCCCCCGAGCTGCAGTACATCCTCAACCA
CAGCGAGGCCTCTCTGCTCGTCACCTCGGCCAAGCTCGCTGCCAAGGCTGACGAGCTGCTGGCCACGGAGTTGGC
GTCCAAGCCCGTCCGTCTGCGGCTGGACAAGCACCTTGAAGGCGAAGCGCCGTCGAAGCCCGTATCCATCGACGA
GCCCCATGTCGCCCATGCCAGTCTCATGCTATACACGTCCGGGACGACGAGCCGTCCGGTAAGAAGGAGTCGAGA
TGGATCGTGAGATGGCATACTGACCGCCTGTCTACAGAAGGGCGTCGTCCTGCCACACTCGGTCCTCGAGGCCCA
ATCCCGGTCCCTCATCGAGGCCTGGCGCTACACCCCCTCAGACCGCCTCCTCCATGTCCTGCCTCTGAACCACAT
CCACGGCGTGGTCAACGCCCTCATCACGCCCCTCGTTGCCGGCTCCTCGGTCGAGTTCATGTTTCCCTTTAACGC
TAATGCCGTATGGAACCGGCTGGCGGCGCCCTTTACCTCGGTTGATGACGACAACAGCAGCAGCAGCAAAAGACC
GCATCCAATCACCCTCTTCACCGTCGTGCCCACCGTCTACAGCCGTCTGATGGCCTCACACGCATCCCTCCCTCG
CCACGTGGCCGACGCCGCCCGCACCGCCATCTCACCCGCCAACATGCGGCTCGCCATCTCCGGTTCGGCCGCTCT
GCCAACCCCCGTAAAGACGGCATGGCGCGACCTGAGCGGCGGAAACGTCCTACTCGAGCGCTACGGCATGACCGA
AGTCGGCATGGCCCTCAGCTGCGGCCTCGATCCGGCAGATCGGGTCGACGCCAGCGTTGGATGGCCGCTGCCTTC
GGTCCAGCTCCGTCTCGTCGACCTCGACTCCGGTCGTGTCATCGCCGACGACGCCCTCGATCAGCCCGGCGAGAT
TCACTTGCGCGGCCCAACCGTCTTCAGCCAGTACTGGAACAACCCAGACGCCACGGCCAACGCCTTCGTCGATGA
CCCGAACGGCGGCCAGCCCTGGTTCCGCACCGGCGACGTCGCCCTCCGTCGCGCCGTGGCGACAGCTGGCCTCAA
CCCGACGCAGCGAGATTGGGCGCGCGGCCCCGTCTTCTTCGTCCAGGGCCGCGTCAGCGCCGACATCATCAAGAC
GGGCGGCGAAAAGGTCAGCGCCCTCGAGGTCGAGCGCGAGCTGCTCTCCCTACCCGAGGTAGCCGAGGCCGCCGT
CGTGGCTGTGCCGAGCGGTAACTGGGGGCAAAAGGTGGGCGCTGTCGTCGTCCTTGACCAGCAGGTGGCGCACAA
GTGGACGCCGCTCGAGATGCGCCGCGCTCTCAAGGGTCGCCTCGCTGCCTTTAAGATCCCTCAGGCTCTCAAGGT
CGTACCGCAGATCCCTCGCAACGCCATGGGCAAGGTCAACAAAAAGGAGCTCGTTCGCGCCGTCTTCGCCGACGA
GTTTAGCGGTGATGAGAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail