Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|607
Gene name
LocationContig_119:27058..28686
Strand-
Gene length (bp)1628
Transcript length (bp)1392
Coding sequence length (bp)1392
Protein length (aa) 464

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.2E-31 20 406

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 25 459 7.0E-47
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 28 447 3.0E-42
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 50 402 2.0E-17
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 25 407 1.0E-16
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 41 447 5.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 25 459 7.0E-47
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 28 447 3.0E-42
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 50 402 2.0E-17
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 25 407 1.0E-16
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 41 447 5.0E-14
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 25 383 2.0E-12
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 25 383 2.0E-12
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 18 192 1.0E-07
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 26 413 3.0E-07
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 48 457 3.0E-06
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 48 457 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 38 60 22
2 67 86 19
3 152 174 22
4 242 264 22
5 284 306 22
6 327 349 22
7 359 381 22
8 394 416 22
9 421 443 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|607
MAQTLALWSPHRHDIGHLHGPIFWNQMLKDIHVTQLDLTNGGTVKLGGTAVGCIVFIPFAKKYGRRSVYIVSTAL
VAAGVWWTAYMKTTAEVYLTNFVIGMAGAVNQAAVQMSTRDLFFVHQRGTVNGIYFIASKTGTSLTPMIAGAHAA
KAGYRASYVSLAVCLTLITLLFAGTLEETKFVARDEDGDEKSVDMAEAASASEVDRIVAPLRAPFPRYLRLELIT
ETKESLLSLFREPLQTWWWPHVLFASVVYGMGICWFVVLGTVTAIRFVQEPYGFDSAQVGYMFGASAIGAVFGCL
YGGFLTDKSIQWLARRNGGVFEPEMRFYLLPLPAVTLSAGLVIFGATTDQGAHWLFPALGIVVFSFGFGATADIV
CTVVIDSYPDLVAQTFMAVAFCRNTVSMIGPVSISGWMEVMSITNIFITAAFISLAINLTGIPLAIWGKRSRAAI
APKYYKLVGNKVN*
Coding >Ophun1|607
ATGGCGCAAACTCTGGCACTATGGTCTCCTCACCGCCATGACATTGGCCATCTACACGGCCCCATCTTCTGGAAC
CAGATGCTCAAAGACATACACGTCACCCAGCTTGATCTCACCAACGGGGGGACAGTCAAGCTGGGCGGCACGGCT
GTGGGATGCATCGTCTTCATCCCCTTTGCCAAGAAATACGGTCGACGGTCCGTGTACATCGTCTCGACGGCTCTG
GTAGCTGCGGGCGTCTGGTGGACTGCCTATATGAAGACGACAGCAGAGGTCTATCTCACAAACTTCGTCATCGGG
ATGGCTGGGGCGGTCAACCAGGCTGCTGTGCAGATGAGTACACGAGACCTGTTCTTCGTCCATCAGAGAGGCACG
GTAAACGGCATCTACTTCATCGCCAGTAAGACGGGAACCTCGCTCACGCCCATGATAGCCGGAGCCCATGCAGCA
AAGGCCGGATATAGGGCGAGTTACGTCTCGCTGGCTGTTTGCCTCACCCTCATCACCTTGCTCTTCGCCGGGACG
TTGGAGGAGACCAAGTTCGTGGCTAGAGATGAGGATGGTGATGAGAAGAGCGTCGATATGGCTGAGGCGGCTTCG
GCTTCGGAGGTTGATCGCATCGTGGCACCTTTACGAGCCCCCTTCCCTCGTTACCTTCGTCTCGAGCTCATCACT
GAGACGAAAGAGTCCCTACTCAGCCTGTTCCGCGAGCCGCTTCAGACATGGTGGTGGCCACACGTGCTCTTCGCG
TCAGTCGTCTACGGCATGGGCATCTGCTGGTTTGTTGTCCTCGGGACCGTGACGGCCATCCGGTTCGTGCAAGAG
CCGTACGGCTTCGACTCGGCGCAGGTGGGCTACATGTTTGGAGCGAGCGCCATTGGCGCCGTCTTTGGCTGTCTT
TACGGCGGCTTTCTCACCGATAAGAGTATTCAGTGGCTGGCCAGACGCAACGGGGGCGTGTTTGAGCCTGAGATG
CGCTTCTATCTTTTACCGTTGCCTGCTGTTACGCTTTCTGCTGGGCTGGTTATCTTTGGAGCCACGACGGATCAG
GGGGCTCACTGGCTCTTCCCTGCCCTGGGAATCGTCGTCTTCTCCTTTGGCTTCGGCGCAACGGCAGATATTGTC
TGCACTGTCGTCATCGACTCATACCCTGACCTTGTTGCTCAAACTTTCATGGCCGTCGCTTTCTGCCGCAACACC
GTCAGCATGATTGGGCCGGTGTCGATAAGCGGTTGGATGGAGGTGATGAGCATTACCAACATCTTCATCACAGCT
GCTTTTATCAGCCTGGCTATTAACTTGACGGGCATCCCGCTTGCCATCTGGGGGAAGAGGTCGAGGGCTGCCATT
GCTCCTAAATACTATAAGCTGGTGGGAAACAAGGTCAATTAG
Transcript >Ophun1|607
ATGGCGCAAACTCTGGCACTATGGTCTCCTCACCGCCATGACATTGGCCATCTACACGGCCCCATCTTCTGGAAC
CAGATGCTCAAAGACATACACGTCACCCAGCTTGATCTCACCAACGGGGGGACAGTCAAGCTGGGCGGCACGGCT
GTGGGATGCATCGTCTTCATCCCCTTTGCCAAGAAATACGGTCGACGGTCCGTGTACATCGTCTCGACGGCTCTG
GTAGCTGCGGGCGTCTGGTGGACTGCCTATATGAAGACGACAGCAGAGGTCTATCTCACAAACTTCGTCATCGGG
ATGGCTGGGGCGGTCAACCAGGCTGCTGTGCAGATGAGTACACGAGACCTGTTCTTCGTCCATCAGAGAGGCACG
GTAAACGGCATCTACTTCATCGCCAGTAAGACGGGAACCTCGCTCACGCCCATGATAGCCGGAGCCCATGCAGCA
AAGGCCGGATATAGGGCGAGTTACGTCTCGCTGGCTGTTTGCCTCACCCTCATCACCTTGCTCTTCGCCGGGACG
TTGGAGGAGACCAAGTTCGTGGCTAGAGATGAGGATGGTGATGAGAAGAGCGTCGATATGGCTGAGGCGGCTTCG
GCTTCGGAGGTTGATCGCATCGTGGCACCTTTACGAGCCCCCTTCCCTCGTTACCTTCGTCTCGAGCTCATCACT
GAGACGAAAGAGTCCCTACTCAGCCTGTTCCGCGAGCCGCTTCAGACATGGTGGTGGCCACACGTGCTCTTCGCG
TCAGTCGTCTACGGCATGGGCATCTGCTGGTTTGTTGTCCTCGGGACCGTGACGGCCATCCGGTTCGTGCAAGAG
CCGTACGGCTTCGACTCGGCGCAGGTGGGCTACATGTTTGGAGCGAGCGCCATTGGCGCCGTCTTTGGCTGTCTT
TACGGCGGCTTTCTCACCGATAAGAGTATTCAGTGGCTGGCCAGACGCAACGGGGGCGTGTTTGAGCCTGAGATG
CGCTTCTATCTTTTACCGTTGCCTGCTGTTACGCTTTCTGCTGGGCTGGTTATCTTTGGAGCCACGACGGATCAG
GGGGCTCACTGGCTCTTCCCTGCCCTGGGAATCGTCGTCTTCTCCTTTGGCTTCGGCGCAACGGCAGATATTGTC
TGCACTGTCGTCATCGACTCATACCCTGACCTTGTTGCTCAAACTTTCATGGCCGTCGCTTTCTGCCGCAACACC
GTCAGCATGATTGGGCCGGTGTCGATAAGCGGTTGGATGGAGGTGATGAGCATTACCAACATCTTCATCACAGCT
GCTTTTATCAGCCTGGCTATTAACTTGACGGGCATCCCGCTTGCCATCTGGGGGAAGAGGTCGAGGGCTGCCATT
GCTCCTAAATACTATAAGCTGGTGGGAAACAAGGTCAATTAG
Gene >Ophun1|607
ATGGCGCAAACTCTGGCACTATGGTCTCCTCACCGCCATGACATTGGCCATCTACACGGCGTAAGCCAGACGATT
CCCCTGATTCCAGTCGATATGTATCAATCTGACAGACAGCTCAAGACTCGGCGTCCAGCCCATCTTCTGGAACCA
GATGCTCAAAGACATACACGTCACCCAGCTTGATCTCACCAACGGGGGGACAGTCAAGCTGGGCGGCACGGCTGT
GGGATGCATCGTCTTCATCCCCTTTGCCAAGAAATACGGTCGACGGTCCGTGTACATCGTCTCGACGGCTCTGGT
AGCTGCGGGCGTCTGGTGGACTGCCTATATGAAGACGACAGCAGAGGTCTATCTCACAAACTTCGTCATCGGGAT
GGCTGGGGCGGTCAACCAGGCTGCTGTGCAGATGAGTGTATGCCTTGAAACCCACCTTGTCAGAAGCCCCTCTAA
CCCCCTCAGACACGAGACCTGTTCTTCGTCCATCAGAGAGGCACGGTAAACGGCATCTACTTCATCGCCAGTAAG
ACGGGAACCTCGCTCACGCCCATGATAGCCGGAGCCCATGCAGCAAAGGCCGGATATAGGGCGAGTTACGTCTCG
CTGGCTGTTTGCCTCACCCTCATCACCTTGCTCTTCGCCGGGACGTTGGAGGAGACCAAGTTCGTGGCTAGAGAT
GAGGATGGTGATGAGAAGAGCGTCGATATGGCTGAGGCGGCTTCGGCTTCGGAGGTTGATCGCATCGTGGCACCT
TTACGAGCCCCCTTCCCTCGTTACCTTCGTCTCGAGCTCATCACTGAGACGAAAGAGTCCCTACTCAGCCTGTTC
CGCGAGCCGCTTCAGACATGGTGGTGGCCACACGTGCTCTTCGCGTCAGTCGTCTACGGCATGGGCATCTGCTGG
TTTGTTGTCCTCGGGACCGTGACGGCCATCCGGTTCGTGCAAGAGCCGTACGGCTTCGACTCGGCGCAGGTGGGC
TACATGTTTGGAGCGAGCGCCATTGGCGCCGTCTTTGGCTGTCTTTACGGCGGCTTTCTCACCGATAAGAGTATT
CAGTGGCTGGCCAGACGCAACGGGGGCGTGTTTGAGCCTGAGATGCGCTTCTATCTTTTACCGTTGCCTGCTGTT
ACGCTTTCTGCTGGGCTGGTTATCTTTGGAGCCACGACGGATCAGGTATGTCGTTCCCTTGTTGTTGAGATTAGG
CCGTTGCTGACGATGAATAGGGGGCTCACTGGCTCTTCCCTGCCCTGGGAATCGTCGTCTTCTCCTTTGGCTTCG
GCGCAACGGCAGATATTGTCTGCACTGTCGTCATCGACTCATACCCTGACGTGAGTTTCCATCAATCTTTCCATG
GTACATGTACGAGAAAAGGGGTTCTGACTGGAAACTTGAAGCTTGTTGCTCAAACTTTCATGGCCGTCGCTTTCT
GCCGCAACACCGTCAGCATGATTGGGCCGGTGTCGATAAGCGGTTGGATGGAGGTGATGAGCATTACCAACATCT
TCATCACAGCTGCTTTTATCAGCCTGGCTATTAACTTGACGGGCATCCCGCTTGCCATCTGGGGGAAGAGGTCGA
GGGCTGCCATTGCTCCTAAATACTATAAGCTGGTGGGAAACAAGGTCAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail