Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6068
Gene name
LocationContig_638:3335..3902
Strand-
Gene length (bp)567
Transcript length (bp)567
Coding sequence length (bp)567
Protein length (aa) 189

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12720 DUF3807 Protein of unknown function (DUF3807) 4.7E-32 38 187

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9USY8|YBPF_SCHPO Uncharacterized protein C16H5.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16H5.15 PE=4 SV=1 38 116 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6068
MNCREAQYTLRPVARPSFKSVQALLRCDANRADRVQDDLTDFLQSHFAAEAVFHFGQTFRNPSVFTQAQASGCQL
GETVEDDLGYYDDGVKRTLTDEQIDLFRRSELREMLLKQRKAVSDRSTKSAAAGAAEEGPDAASSSASGVKRKRK
KKRKNKNGAPKPRYEPKPDLRKRTWDVVDKGLDSLDYG*
Coding >Ophun1|6068
ATGAACTGCCGAGAGGCCCAATACACATTGCGCCCGGTGGCCCGCCCATCTTTCAAGTCAGTCCAGGCCCTACTG
CGCTGCGACGCAAACCGAGCTGACCGGGTGCAGGACGATCTCACCGATTTCCTTCAGAGCCATTTCGCGGCAGAG
GCAGTATTTCATTTCGGTCAGACGTTCCGAAATCCTTCGGTATTCACTCAGGCGCAAGCATCGGGCTGTCAGCTT
GGTGAGACGGTAGAGGATGACCTTGGCTACTACGACGACGGCGTCAAGCGCACCCTGACGGACGAGCAAATCGAT
TTGTTTCGGCGGTCCGAGCTGAGGGAGATGCTCCTTAAACAGCGGAAGGCGGTCTCGGATCGTTCTACGAAATCG
GCTGCAGCCGGCGCGGCAGAGGAGGGGCCTGACGCTGCTTCGTCTTCGGCGTCAGGTGTCAAGCGCAAGCGCAAG
AAGAAGAGGAAGAACAAGAACGGTGCGCCTAAGCCGCGGTACGAGCCGAAGCCGGACCTGCGGAAGCGAACCTGG
GATGTGGTCGACAAGGGCCTCGACTCGCTCGATTATGGTTGA
Transcript >Ophun1|6068
ATGAACTGCCGAGAGGCCCAATACACATTGCGCCCGGTGGCCCGCCCATCTTTCAAGTCAGTCCAGGCCCTACTG
CGCTGCGACGCAAACCGAGCTGACCGGGTGCAGGACGATCTCACCGATTTCCTTCAGAGCCATTTCGCGGCAGAG
GCAGTATTTCATTTCGGTCAGACGTTCCGAAATCCTTCGGTATTCACTCAGGCGCAAGCATCGGGCTGTCAGCTT
GGTGAGACGGTAGAGGATGACCTTGGCTACTACGACGACGGCGTCAAGCGCACCCTGACGGACGAGCAAATCGAT
TTGTTTCGGCGGTCCGAGCTGAGGGAGATGCTCCTTAAACAGCGGAAGGCGGTCTCGGATCGTTCTACGAAATCG
GCTGCAGCCGGCGCGGCAGAGGAGGGGCCTGACGCTGCTTCGTCTTCGGCGTCAGGTGTCAAGCGCAAGCGCAAG
AAGAAGAGGAAGAACAAGAACGGTGCGCCTAAGCCGCGGTACGAGCCGAAGCCGGACCTGCGGAAGCGAACCTGG
GATGTGGTCGACAAGGGCCTCGACTCGCTCGATTATGGTTGA
Gene >Ophun1|6068
ATGAACTGCCGAGAGGCCCAATACACATTGCGCCCGGTGGCCCGCCCATCTTTCAAGTCAGTCCAGGCCCTACTG
CGCTGCGACGCAAACCGAGCTGACCGGGTGCAGGACGATCTCACCGATTTCCTTCAGAGCCATTTCGCGGCAGAG
GCAGTATTTCATTTCGGTCAGACGTTCCGAAATCCTTCGGTATTCACTCAGGCGCAAGCATCGGGCTGTCAGCTT
GGTGAGACGGTAGAGGATGACCTTGGCTACTACGACGACGGCGTCAAGCGCACCCTGACGGACGAGCAAATCGAT
TTGTTTCGGCGGTCCGAGCTGAGGGAGATGCTCCTTAAACAGCGGAAGGCGGTCTCGGATCGTTCTACGAAATCG
GCTGCAGCCGGCGCGGCAGAGGAGGGGCCTGACGCTGCTTCGTCTTCGGCGTCAGGTGTCAAGCGCAAGCGCAAG
AAGAAGAGGAAGAACAAGAACGGTGCGCCTAAGCCGCGGTACGAGCCGAAGCCGGACCTGCGGAAGCGAACCTGG
GATGTGGTCGACAAGGGCCTCGACTCGCTCGATTATGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail