Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6058
Gene name
LocationContig_635:1048..2567
Strand+
Gene length (bp)1519
Transcript length (bp)1137
Coding sequence length (bp)1137
Protein length (aa) 379

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08316 Pal1 Pal1 cell morphology protein 9.2E-06 147 194

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2746
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3926
Ophiocordyceps australis map64 (Brazil) OphauB2|6306
Ophiocordyceps camponoti-floridani Ophcf2|02451
Ophiocordyceps camponoti-rufipedis Ophun1|6058 (this protein)
Ophiocordyceps kimflemingae Ophio5|5634
Ophiocordyceps subramaniannii Hirsu2|4340

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6058
MFGKDTTAMKNGVMSKLLAPASKAKALLGHKSARKAAKEFYRRITAEPDATSTDKVVRWQASFLDPFSTPEPFQE
TGLGASLVRQTANADVSGEHTIDALASRAWLPSCTHDASDWAALDHALSMAGAERGRGGPLPEKATMPPYTDAID
ALDTIGPRYHHPGPYDAALPSRNADATTSPLAAVHDSNMEALRATPRENVIDALSRHVPLQGVASIPPGQTDPSG
RVMDYVEGADLMREADSPGGAYKRWPGLNYHPDDLKGKGEPEFTIGKQHHGRASHRLSVPVLGKGEKHRRSSHRL
SVPVQSKEEKHRHNNHRLSFSVQADRKDEKHRHLSLPVQSKDAHPQASLRRSLSTGKARLMRRLSSVRHRKSDED
AAV*
Coding >Ophun1|6058
ATGTTCGGCAAAGACACCACCGCCATGAAGAACGGGGTCATGAGCAAGCTGCTCGCCCCGGCAAGCAAAGCAAAA
GCCCTCCTCGGCCACAAATCCGCCCGCAAAGCCGCCAAAGAATTCTACCGCAGAATCACTGCTGAACCGGATGCC
ACGTCAACTGACAAAGTGGTCAGATGGCAGGCCTCCTTCCTGGACCCCTTCTCAACCCCAGAACCCTTCCAAGAG
ACCGGCTTGGGCGCAAGTCTGGTGCGGCAGACTGCGAATGCGGACGTCTCGGGCGAGCACACCATCGACGCTCTG
GCTTCTCGCGCCTGGCTTCCCTCTTGCACGCATGACGCTTCTGACTGGGCTGCGCTCGACCACGCCCTCTCCATG
GCGGGAGCAGAGCGAGGGCGAGGTGGACCCCTGCCCGAGAAAGCCACCATGCCCCCCTACACCGACGCAATCGAC
GCCCTCGACACCATCGGCCCTCGATATCACCATCCAGGCCCCTACGATGCCGCCCTACCCTCTCGCAACGCCGAC
GCAACAACCTCGCCCCTCGCCGCCGTCCACGACTCCAACATGGAAGCCCTCCGCGCCACGCCCCGCGAGAACGTC
ATCGACGCGCTGAGCCGCCACGTGCCCCTCCAGGGCGTCGCCTCCATCCCGCCGGGCCAGACGGATCCTTCGGGC
AGGGTCATGGACTATGTTGAGGGTGCGGATCTGATGCGCGAGGCTGATTCGCCGGGAGGGGCGTATAAGAGGTGG
CCGGGGTTGAACTATCATCCCGATGATCTCAAGGGGAAAGGCGAGCCCGAGTTTACCATTGGGAAGCAGCATCAT
GGACGGGCAAGTCATCGGCTGAGCGTCCCGGTTCTGGGCAAAGGCGAGAAGCACCGTCGCAGCAGCCACCGACTC
AGCGTCCCGGTTCAGAGCAAGGAGGAGAAGCATCGTCACAACAACCACCGCCTCAGTTTCAGCGTACAAGCTGAT
CGCAAAGACGAAAAACACCGCCACCTCAGCCTCCCAGTCCAAAGCAAAGACGCCCATCCGCAAGCCAGCCTCCGC
CGCAGCCTCTCAACCGGCAAGGCCCGCCTGATGCGCCGCCTGAGCAGCGTGCGGCATCGCAAGTCGGACGAGGAC
GCTGCCGTCTGA
Transcript >Ophun1|6058
ATGTTCGGCAAAGACACCACCGCCATGAAGAACGGGGTCATGAGCAAGCTGCTCGCCCCGGCAAGCAAAGCAAAA
GCCCTCCTCGGCCACAAATCCGCCCGCAAAGCCGCCAAAGAATTCTACCGCAGAATCACTGCTGAACCGGATGCC
ACGTCAACTGACAAAGTGGTCAGATGGCAGGCCTCCTTCCTGGACCCCTTCTCAACCCCAGAACCCTTCCAAGAG
ACCGGCTTGGGCGCAAGTCTGGTGCGGCAGACTGCGAATGCGGACGTCTCGGGCGAGCACACCATCGACGCTCTG
GCTTCTCGCGCCTGGCTTCCCTCTTGCACGCATGACGCTTCTGACTGGGCTGCGCTCGACCACGCCCTCTCCATG
GCGGGAGCAGAGCGAGGGCGAGGTGGACCCCTGCCCGAGAAAGCCACCATGCCCCCCTACACCGACGCAATCGAC
GCCCTCGACACCATCGGCCCTCGATATCACCATCCAGGCCCCTACGATGCCGCCCTACCCTCTCGCAACGCCGAC
GCAACAACCTCGCCCCTCGCCGCCGTCCACGACTCCAACATGGAAGCCCTCCGCGCCACGCCCCGCGAGAACGTC
ATCGACGCGCTGAGCCGCCACGTGCCCCTCCAGGGCGTCGCCTCCATCCCGCCGGGCCAGACGGATCCTTCGGGC
AGGGTCATGGACTATGTTGAGGGTGCGGATCTGATGCGCGAGGCTGATTCGCCGGGAGGGGCGTATAAGAGGTGG
CCGGGGTTGAACTATCATCCCGATGATCTCAAGGGGAAAGGCGAGCCCGAGTTTACCATTGGGAAGCAGCATCAT
GGACGGGCAAGTCATCGGCTGAGCGTCCCGGTTCTGGGCAAAGGCGAGAAGCACCGTCGCAGCAGCCACCGACTC
AGCGTCCCGGTTCAGAGCAAGGAGGAGAAGCATCGTCACAACAACCACCGCCTCAGTTTCAGCGTACAAGCTGAT
CGCAAAGACGAAAAACACCGCCACCTCAGCCTCCCAGTCCAAAGCAAAGACGCCCATCCGCAAGCCAGCCTCCGC
CGCAGCCTCTCAACCGGCAAGGCCCGCCTGATGCGCCGCCTGAGCAGCGTGCGGCATCGCAAGTCGGACGAGGAC
GCTGCCGTCTGA
Gene >Ophun1|6058
ATGTTCGGCAAAGACACCACCGCCATGAAGAACGGGGTCATGAGCAAGCTGCTCGCCCCGGCAAGCAAAGCAAAA
GCCCTCCTCGGCCACAAATCCGCCCGCAAAGCCGCCAAAGAATTCTACCGCAGAATCACTGCTGAACCGGATGCC
ACGTCAACTGACAAAGTGGTCAGATGGGTGAGTCGACAGATTCCTCAGCGTCCCACCGGCTGCCAAATACACACA
GACAGATTGATAGCCCCATCCCACTTTTTGTCTTATATGTATGTATGTATGTAAGTAAACAGGGTGCTAACTCGC
TCTTGGCTCTAGCAGGCCTCCTTCCTGGACCCCTTCTCAACCCCAGAACCCTTCCAAGAGACCGGCTTGGGCGCA
AGTCTGGTGCGGCAGACTGCGAATGCGGACGTCTCGGGCGAGCACACCATCGACGCTCTGGCTTCTCGCGCCTGG
CTTCCCTCTTGCACGCATGACGCTTCTGACTGGGCTGCGCTCGACCACGCCCTCTCCATGGCGGGAGCAGAGCGA
GGGCGAGGTGGAGTCGGTCCAAACACAAGGGGTACGTCATGGCCGCTTGGCTGGGCCGGGGCATCCCGGAAGGAT
GTCCATGCGTGGTATAAGTATTTTGATGGCGCCGAGACGGACGGGTTTTCGTCTGGGTCCTCTTGTTGCTCGTCT
TGCACCACCCTATCCGTTGACAGCAACTCGCTGCTCACGCCCTTGTAGTGAGTCCTGTCTTGACAACTCACAACT
CGAACAACCAACCAACTAACTCAACCAACCACAGCCCCTGCCCGAGAAAGCCACCATGCCCCCCTACACCGACGC
AATCGACGCCCTCGACACCATCGGCCCTCGATATCACCATCCAGGCCCCTACGATGCCGCCCTACCCTCTCGCAA
CGCCGACGCAACAACCTCGCCCCTCGCCGCCGTCCACGACTCCAACATGGAAGCCCTCCGCGCCACGCCCCGCGA
GAACGTCATCGACGCGCTGAGCCGCCACGTGCCCCTCCAGGGCGTCGCCTCCATCCCGCCGGGCCAGACGGATCC
TTCGGGCAGGGTCATGGACTATGTTGAGGGTGCGGATCTGATGCGCGAGGCTGATTCGCCGGGAGGGGCGTATAA
GAGGTGGCCGGGGTTGAACTATCATCCCGATGATCTCAAGGGGAAAGGCGAGCCCGAGTTTACCATTGGGAAGCA
GCATCATGGACGGGCAAGTCATCGGCTGAGCGTCCCGGTTCTGGGCAAAGGCGAGAAGCACCGTCGCAGCAGCCA
CCGACTCAGCGTCCCGGTTCAGAGCAAGGAGGAGAAGCATCGTCACAACAACCACCGCCTCAGTTTCAGCGTACA
AGCTGATCGCAAAGACGAAAAACACCGCCACCTCAGCCTCCCAGTCCAAAGCAAAGACGCCCATCCGCAAGCCAG
CCTCCGCCGCAGCCTCTCAACCGGCAAGGCCCGCCTGATGCGCCGCCTGAGCAGCGTGCGGCATCGCAAGTCGGA
CGAGGACGCTGCCGTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail