Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6055
Gene name
LocationContig_634:4754..6418
Strand+
Gene length (bp)1664
Transcript length (bp)1566
Coding sequence length (bp)1566
Protein length (aa) 522

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00291 PALP Pyridoxal-phosphate dependent enzyme 3.0E-69 20 318
PF00571 CBS CBS domain 1.2E-08 373 422

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46794|CBS_DICDI Cystathionine beta-synthase OS=Dictyostelium discoideum GN=cysB PE=2 SV=2 21 517 1.0E-172
sp|P32582|CBS_YEAST Cystathionine beta-synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYS4 PE=1 SV=1 21 516 4.0E-172
sp|P32232|CBS_RAT Cystathionine beta-synthase OS=Rattus norvegicus GN=Cbs PE=1 SV=3 23 437 1.0E-156
sp|Q91WT9|CBS_MOUSE Cystathionine beta-synthase OS=Mus musculus GN=Cbs PE=1 SV=3 23 520 7.0E-156
sp|P35520|CBS_HUMAN Cystathionine beta-synthase OS=Homo sapiens GN=CBS PE=1 SV=2 23 516 2.0E-151
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46794|CBS_DICDI Cystathionine beta-synthase OS=Dictyostelium discoideum GN=cysB PE=2 SV=2 21 517 1.0E-172
sp|P32582|CBS_YEAST Cystathionine beta-synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYS4 PE=1 SV=1 21 516 4.0E-172
sp|P32232|CBS_RAT Cystathionine beta-synthase OS=Rattus norvegicus GN=Cbs PE=1 SV=3 23 437 1.0E-156
sp|Q91WT9|CBS_MOUSE Cystathionine beta-synthase OS=Mus musculus GN=Cbs PE=1 SV=3 23 520 7.0E-156
sp|P35520|CBS_HUMAN Cystathionine beta-synthase OS=Homo sapiens GN=CBS PE=1 SV=2 23 516 2.0E-151
sp|Q58H57|CBS_MACFA Cystathionine beta-synthase OS=Macaca fascicularis GN=CBS PE=2 SV=3 23 516 7.0E-151
sp|Q9N0V7|CBS_RABIT Cystathionine beta-synthase OS=Oryctolagus cuniculus GN=CBS PE=2 SV=3 23 519 2.0E-144
sp|Q8CMT6|CYSK_STAES Cysteine synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cysK PE=3 SV=1 20 325 2.0E-74
sp|Q5HRP1|CYSK_STAEQ Cysteine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cysK PE=3 SV=1 20 325 2.0E-74
sp|P9WP51|Y1077_MYCTU Putative cystathionine beta-synthase Rv1077 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cbs PE=1 SV=1 20 516 7.0E-73
sp|P9WP50|Y1077_MYCTO Putative cystathionine beta-synthase MT1108 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cbs PE=3 SV=1 20 516 7.0E-73
sp|P63872|CYSK_STAAW Cysteine synthase OS=Staphylococcus aureus (strain MW2) GN=cysK PE=3 SV=1 20 331 1.0E-72
sp|Q6GBX5|CYSK_STAAS Cysteine synthase OS=Staphylococcus aureus (strain MSSA476) GN=cysK PE=3 SV=1 20 331 1.0E-72
sp|Q6GJF8|CYSK_STAAR Cysteine synthase OS=Staphylococcus aureus (strain MRSA252) GN=cysK PE=3 SV=1 20 331 1.0E-72
sp|P63871|CYSK_STAAN Cysteine synthase OS=Staphylococcus aureus (strain N315) GN=cysK PE=1 SV=1 20 331 1.0E-72
sp|P63870|CYSK_STAAM Cysteine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cysK PE=3 SV=1 20 331 1.0E-72
sp|Q5HIG2|CYSK_STAAC Cysteine synthase OS=Staphylococcus aureus (strain COL) GN=cysK PE=3 SV=1 20 331 1.0E-72
sp|O01592|CYSK3_CAEEL Cysteine synthase 3 OS=Caenorhabditis elegans GN=cysl-3 PE=1 SV=1 16 333 3.0E-66
sp|O45679|CYSK2_CAEEL Bifunctional L-3-cyanoalanine synthase/cysteine synthase OS=Caenorhabditis elegans GN=cysl-2 PE=1 SV=1 16 325 1.0E-65
sp|O05393|MCCA_BACSU O-acetylserine dependent cystathionine beta-synthase OS=Bacillus subtilis (strain 168) GN=mccA PE=1 SV=1 20 326 1.0E-65
sp|P9WP55|CYSK_MYCTU O-acetylserine sulfhydrylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysK1 PE=1 SV=1 20 329 6.0E-64
sp|P9WP54|CYSK_MYCTO O-acetylserine sulfhydrylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysK1 PE=3 SV=1 20 329 6.0E-64
sp|P0A535|CYSK_MYCBO O-acetylserine sulfhydrylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysK PE=3 SV=1 20 329 6.0E-64
sp|Q7DDL5|CYSK_NEIMB Cysteine synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysK PE=1 SV=1 18 329 8.0E-64
sp|P73410|CYSK_SYNY3 Cysteine synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysK PE=3 SV=2 20 325 9.0E-64
sp|O32978|CYSK_MYCLE O-acetylserine sulfhydrylase OS=Mycobacterium leprae (strain TN) GN=cysK PE=3 SV=1 20 329 6.0E-63
sp|Q5XAQ3|CYSK_STRP6 Cysteine synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=cysK PE=1 SV=3 20 325 1.0E-62
sp|Q9XEA8|CYSK2_ORYSJ Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS3 PE=2 SV=1 19 325 3.0E-62
sp|P56067|CYSM_HELPY Cysteine synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=cysM PE=1 SV=1 16 326 9.0E-62
sp|O34476|CYSM_BACSU Probable cysteine synthase OS=Bacillus subtilis (strain 168) GN=ytkP PE=3 SV=1 16 332 8.0E-61
sp|Q93244|CYSK1_CAEEL Cysteine synthase 1 OS=Caenorhabditis elegans GN=cysl-1 PE=1 SV=2 18 325 9.0E-61
sp|Q00834|CYSK_SPIOL Cysteine synthase OS=Spinacia oleracea PE=1 SV=1 20 330 7.0E-60
sp|Q43317|CYSK_CITLA Cysteine synthase OS=Citrullus lanatus PE=1 SV=1 20 325 1.0E-59
sp|P50867|CYSK_EMENI Cysteine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cysB PE=3 SV=2 20 338 2.0E-59
sp|P38076|CYSK_WHEAT Cysteine synthase OS=Triticum aestivum GN=CYS1 PE=2 SV=1 13 325 3.0E-59
sp|O81155|CYSKP_SOLTU Cysteine synthase, chloroplastic/chromoplastic OS=Solanum tuberosum PE=2 SV=1 20 325 3.0E-59
sp|Q9ZMW6|CYSM_HELPJ Cysteine synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=cysM PE=3 SV=1 16 326 7.0E-59
sp|O23735|CYSK2_BRAJU Cysteine synthase OS=Brassica juncea PE=2 SV=1 20 330 8.0E-59
sp|P47998|CYSK1_ARATH Cysteine synthase 1 OS=Arabidopsis thaliana GN=OASA1 PE=1 SV=2 20 330 9.0E-59
sp|Q9I526|CYSM_PSEAE Cysteine synthase B OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysM PE=3 SV=1 20 325 1.0E-58
sp|O23733|CYSK1_BRAJU Cysteine synthase OS=Brassica juncea PE=2 SV=1 20 325 1.0E-58
sp|P80608|CYSK_MAIZE Cysteine synthase OS=Zea mays PE=1 SV=2 13 325 2.0E-58
sp|O81154|CYSK_SOLTU Cysteine synthase OS=Solanum tuberosum PE=2 SV=1 10 325 5.0E-58
sp|Q9XEA6|CYSK1_ORYSJ Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS1 PE=2 SV=2 20 325 1.0E-57
sp|P16703|CYSM_ECOLI Cysteine synthase B OS=Escherichia coli (strain K12) GN=cysM PE=1 SV=1 23 338 2.0E-56
sp|Q76MX2|CAS1_SOLTU Bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial OS=Solanum tuberosum GN=PCAS-1 PE=1 SV=1 20 331 3.0E-56
sp|P37887|CYSK_BACSU Cysteine synthase OS=Bacillus subtilis (strain 168) GN=cysK PE=1 SV=3 18 299 1.0E-55
sp|Q43153|CYSC_SPIOL Bifunctional L-3-cyanoalanine synthase/cysteine synthase, mitochondrial OS=Spinacia oleracea GN=CYSC PE=1 SV=1 6 325 2.0E-55
sp|O59701|CYSK1_SCHPO Cysteine synthase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cys11 PE=3 SV=1 13 339 2.0E-55
sp|P29848|CYSM_SALTY Cysteine synthase B OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysM PE=1 SV=1 23 338 3.0E-55
sp|Q59447|CYSK_FLAS3 Cysteine synthase OS=Flavobacterium sp. (strain K3-15 / DSM ID92-509) GN=cysK PE=3 SV=1 18 287 3.0E-55
sp|P47999|CYSKP_ARATH Cysteine synthase, chloroplastic/chromoplastic OS=Arabidopsis thaliana GN=OASB PE=1 SV=2 18 325 4.0E-55
sp|P0ABK5|CYSK_ECOLI Cysteine synthase A OS=Escherichia coli (strain K12) GN=cysK PE=1 SV=2 23 329 6.0E-55
sp|P0ABK6|CYSK_ECO57 Cysteine synthase A OS=Escherichia coli O157:H7 GN=cysK PE=3 SV=2 23 329 6.0E-55
sp|P32260|CYSKP_SPIOL Cysteine synthase, chloroplastic/chromoplastic OS=Spinacia oleracea GN=CYSK PE=1 SV=2 20 325 7.0E-55
sp|Q1KLZ2|CAS1_MALDO L-3-cyanoalanine synthase 1, mitochondrial OS=Malus domestica GN=CAS1 PE=1 SV=1 20 325 1.0E-54
sp|P0A1E3|CYSK_SALTY Cysteine synthase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysK PE=1 SV=2 23 329 3.0E-54
sp|P0A1E4|CYSK_SALTI Cysteine synthase A OS=Salmonella typhi GN=cysK PE=3 SV=2 23 329 3.0E-54
sp|Q1KLZ1|CAS2_MALDO L-3-cyanoalanine synthase 2, mitochondrial OS=Malus domestica GN=CAS2 PE=1 SV=1 13 331 7.0E-54
sp|P31300|CYSKP_CAPAN Cysteine synthase, chloroplastic/chromoplastic OS=Capsicum annuum PE=2 SV=1 20 325 2.0E-53
sp|Q43725|CYSKM_ARATH Cysteine synthase, mitochondrial OS=Arabidopsis thaliana GN=OASC PE=1 SV=3 18 325 2.0E-53
sp|Q54CN7|CYSK_DICDI Cysteine synthase OS=Dictyostelium discoideum GN=cysK PE=3 SV=1 21 345 3.0E-52
sp|Q9S6Z7|CYSD1_ARATH Bifunctional L-3-cyanoalanine synthase/cysteine synthase D1 OS=Arabidopsis thaliana GN=CYSD1 PE=1 SV=1 19 325 3.0E-51
sp|Q9FS29|CAS2_SOLTU Bifunctional L-3-cyanoalanine synthase/cysteine synthase 2, mitochondrial OS=Solanum tuberosum GN=PCAS-2 PE=1 SV=1 20 331 2.0E-50
sp|Q59966|CYSK_SYNE7 Cysteine synthase OS=Synechococcus elongatus (strain PCC 7942) GN=srpG PE=2 SV=1 20 338 2.0E-50
sp|P87131|CYSK2_SCHPO Cysteine synthase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cys12 PE=3 SV=1 22 333 1.0E-49
sp|Q9S757|CYSC1_ARATH Bifunctional L-3-cyanoalanine synthase/cysteine synthase C1, mitochondrial OS=Arabidopsis thaliana GN=CYSC1 PE=1 SV=1 19 331 2.0E-49
sp|O67507|CYSM_AQUAE Cysteine synthase OS=Aquifex aeolicus (strain VF5) GN=cysM PE=3 SV=1 22 331 4.0E-49
sp|Q9SXS7|CYSD2_ARATH Bifunctional L-3-cyanoalanine synthase/cysteine synthase D2 OS=Arabidopsis thaliana GN=CYSD2 PE=1 SV=1 20 325 1.0E-48
sp|D2Z027|DCSD_STRLA O-ureido-L-serine synthase OS=Streptomyces lavendulae GN=dcsD PE=1 SV=1 21 335 5.0E-47
sp|F4K5T2|CGL_ARATH Bifunctional cystathionine gamma-lyase/cysteine synthase OS=Arabidopsis thaliana GN=DES1 PE=1 SV=1 19 325 5.0E-46
sp|O22682|CYSK4_ARATH Probable S-sulfocysteine synthase, chloroplastic OS=Arabidopsis thaliana GN=At3g03630 PE=1 SV=1 20 325 2.0E-45
sp|Q44004|SBNA_CUPMC Putative siderophore biosynthesis protein SbnA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=sbnA PE=3 SV=2 23 334 4.0E-44
sp|P55708|Y4XP_RHISN Putative cysteine synthase OS=Rhizobium sp. (strain NGR234) GN=NGR_a00730 PE=3 SV=1 18 339 1.0E-43
sp|Q9LJA0|CYSK2_ARATH Putative inactive cysteine synthase 2 OS=Arabidopsis thaliana GN=OASA2 PE=5 SV=2 13 199 5.0E-43
sp|P71128|CYSM_CAMJE Cysteine synthase B OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=cysM PE=3 SV=2 20 325 6.0E-43
sp|P45040|CYSK_HAEIN Cysteine synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cysK PE=1 SV=1 23 325 6.0E-43
sp|Q7A1Z6|SBNA_STAAW Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain MW2) GN=sbnA PE=3 SV=1 21 333 1.0E-41
sp|A8YZ41|SBNA_STAAT Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=sbnA PE=3 SV=1 21 333 1.0E-41
sp|Q6GD09|SBNA_STAAS Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain MSSA476) GN=sbnA PE=3 SV=1 21 333 1.0E-41
sp|Q6GKI9|SBNA_STAAR Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain MRSA252) GN=sbnA PE=3 SV=1 21 333 1.0E-41
sp|Q932K9|SBNA_STAAM Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=sbnA PE=3 SV=1 21 333 1.0E-41
sp|A6QDA0|SBNA_STAAE Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain Newman) GN=sbnA PE=3 SV=1 21 333 1.0E-41
sp|D0K799|SBNA_STAAD Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain ED98) GN=sbnA PE=3 SV=2 21 333 1.0E-41
sp|Q5HJQ3|SBNA_STAAC Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain COL) GN=sbnA PE=3 SV=2 21 333 1.0E-41
sp|A5INY7|SBNA_STAA9 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain JH9) GN=sbnA PE=3 SV=1 21 333 1.0E-41
sp|Q2G1N3|SBNA_STAA8 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain NCTC 8325) GN=sbnA PE=2 SV=2 21 333 1.0E-41
sp|D2N3G7|SBNA_STAA5 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain MRSA ST398 / isolate S0385) GN=sbnA PE=3 SV=1 21 333 1.0E-41
sp|D3ERF5|SBNA_STAA4 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain 04-02981) GN=sbnA PE=3 SV=1 21 333 1.0E-41
sp|Q2FKE3|SBNA_STAA3 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain USA300) GN=sbnA PE=3 SV=2 21 333 1.0E-41
sp|A6TXQ1|SBNA_STAA2 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain JH1) GN=sbnA PE=3 SV=1 21 333 1.0E-41
sp|A7WX68|SBNA_STAA1 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=sbnA PE=3 SV=1 21 333 1.0E-41
sp|D1GUM7|SBNA_STAA0 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain TW20 / 0582) GN=sbnA PE=3 SV=1 21 333 1.0E-41
sp|Q99X99|SBNA_STAAN Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain N315) GN=sbnA PE=3 SV=1 21 333 1.0E-41
sp|Q2YUU0|SBNA_STAAB Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=sbnA PE=3 SV=1 18 333 3.0E-41
sp|Q8XSQ0|SBNA_RALSO Putative siderophore biosynthesis protein SbnA OS=Ralstonia solanacearum (strain GMI1000) GN=sbnA PE=3 SV=1 18 334 3.0E-41
sp|P57171|CYSK_BUCAI Cysteine synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cysK PE=3 SV=1 23 325 1.0E-39
sp|Q8KA48|CYSK_BUCAP Cysteine synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=cysK PE=3 SV=1 23 325 3.0E-37
sp|P53206|CYSK_YEAST Putative cysteine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR012W PE=1 SV=1 21 327 7.0E-37
sp|P48028|CYSM_PSESY Cysteine synthase B (Fragment) OS=Pseudomonas syringae pv. syringae GN=cysM PE=3 SV=1 20 185 2.0E-36
sp|P9WP53|CYSM_MYCTU O-phosphoserine sulfhydrylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysM PE=1 SV=1 23 294 4.0E-35
sp|P9WP52|CYSM_MYCTO O-phosphoserine sulfhydrylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysM PE=3 SV=1 23 294 4.0E-35
sp|P63874|CYSM_MYCBO O-phosphoserine sulfhydrylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysM PE=3 SV=1 23 294 4.0E-35
sp|Q59918|CYSK_STAHA Cysteine synthase (Fragment) OS=Staphylococcus haemolyticus GN=cysK PE=3 SV=1 172 331 5.0E-24
sp|Q79FV4|Y848_MYCTU Uncharacterized pyridoxal phosphate-dependent protein CysK2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysK2 PE=3 SV=1 7 339 2.0E-16
sp|Q9YBL2|CYSO_AERPE Protein CysO OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=cysO PE=1 SV=3 26 349 6.0E-14
sp|P04990|THRC_BACSU Threonine synthase OS=Bacillus subtilis (strain 168) GN=thrC PE=3 SV=1 6 316 1.0E-11
sp|P09123|THRC_BACSL Threonine synthase OS=Bacillus sp. (strain ULM1) GN=thrC PE=3 SV=1 24 316 2.0E-11
sp|Q9GZT4|SRR_HUMAN Serine racemase OS=Homo sapiens GN=SRR PE=1 SV=1 44 298 4.0E-11
sp|A0JNI4|SRR_BOVIN Serine racemase OS=Bos taurus GN=SRR PE=2 SV=1 21 298 2.0E-10
sp|Q54HH2|SRR_DICDI Probable serine racemase OS=Dictyostelium discoideum GN=srr PE=3 SV=1 23 224 3.0E-08
sp|Q19374|YSL1_CAEEL Putative pyridoxal-phosphate dependent protein F13B12.4 OS=Caenorhabditis elegans GN=F13B12.4 PE=1 SV=1 23 333 7.0E-08
sp|Q58860|THRC_METJA Threonine synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=thrC PE=3 SV=1 24 210 8.0E-08
sp|Q10725|FSDH_RALPI Phenylserine dehydratase OS=Ralstonia pickettii GN=psdht PE=1 SV=3 44 302 2.0E-07
sp|Q7XSN8|SRR_ORYSJ Serine racemase OS=Oryza sativa subsp. japonica GN=SERR PE=1 SV=2 43 224 3.0E-07
sp|A2XWA9|SRR_ORYSI Serine racemase OS=Oryza sativa subsp. indica GN=OsI_16936 PE=3 SV=1 43 224 3.0E-07
sp|Q8TQD4|THRC_METAC Threonine synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=thrC PE=1 SV=1 9 211 3.0E-07
sp|Q2PGG3|SRR_ARATH Serine racemase OS=Arabidopsis thaliana GN=SR PE=1 SV=1 44 224 4.0E-07
sp|Q76EQ0|SRR_RAT Serine racemase OS=Rattus norvegicus GN=Srr PE=1 SV=1 17 298 2.0E-06
sp|A0R220|THRC_MYCS2 Threonine synthase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=thrC PE=1 SV=1 22 316 1.0E-05
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup571
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|436
Ophiocordyceps australis map64 (Brazil) OphauB2|228
Ophiocordyceps camponoti-floridani Ophcf2|05399
Ophiocordyceps camponoti-floridani Ophcf2|07080
Ophiocordyceps camponoti-rufipedis Ophun1|1998
Ophiocordyceps camponoti-rufipedis Ophun1|6055 (this protein)
Ophiocordyceps kimflemingae Ophio5|8002
Ophiocordyceps subramaniannii Hirsu2|5434

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6055
MATPTLPFVGRKPATVLSASDLIGNTPLVRLNRVPQSLGVECQVYVKTEMFNAGGSVKDRIALRMVLEAERTGRI
KPGDTLIEPTSGNTGIGLALVGAIKGYKTIITMPEKMSAEKVSVLRALGATIIRTPTQAAFDSPESHIGVARRLE
KEMPNAHILDQYSNPHNPLAHELDTAEEIWEQTGGRVDAVVAGAGTGGTITGLARGLRKHNPNIKIIAADPHGSI
LAQPDELNGDRANESYKVEGIGYDFVPDVLDRGLVDKWYKTDDDESFRLARRLISEEGLLVGGSSGSAMAAMLRA
VKDLDLGRGQIVVVILPDSIRSYLSKFADDDWLAANGLLSNDAVNGAADPGSVPSDLSAADPYRGATVASLRLKP
VTSIDAAATCSEAIETMRDKGFDQLPVLSSSRLVGLVTLGNLLSYISRGRATGQSAVRDVMFDFGRLDEVVTDPR
QGAAGRRSSSSRRKFVEITMDTPLSELSNFFEWNSAAVVTEKSADGAKSLSKPVAIVTKVDLLTWMVNRKL*
Coding >Ophun1|6055
ATGGCGACTCCTACGCTGCCGTTTGTCGGCCGCAAGCCGGCGACGGTGCTTTCGGCTTCGGATCTGATTGGGAAT
ACGCCGCTGGTGAGGCTCAACCGGGTGCCGCAGTCGCTGGGCGTCGAGTGTCAGGTCTATGTCAAGACGGAGATG
TTCAATGCTGGGGGGAGCGTCAAGGATCGCATTGCGCTGCGCATGGTCTTGGAGGCGGAACGCACTGGGAGGATA
AAGCCCGGGGATACGCTGATTGAGCCGACGAGCGGGAATACCGGCATCGGCCTCGCCCTCGTCGGCGCCATCAAG
GGCTACAAAACCATCATCACCATGCCCGAGAAAATGTCGGCCGAAAAAGTATCCGTCCTGCGCGCCCTCGGAGCC
ACCATCATCCGTACTCCCACCCAGGCCGCCTTCGACAGCCCCGAGTCGCACATCGGCGTCGCCCGTCGCTTGGAA
AAGGAGATGCCCAACGCCCACATCCTCGACCAGTACTCCAACCCCCACAACCCGCTTGCCCACGAGCTCGACACC
GCAGAGGAGATTTGGGAGCAGACGGGCGGCCGAGTCGATGCTGTCGTCGCCGGCGCCGGCACCGGAGGGACCATC
ACCGGCTTGGCCAGGGGTCTCCGGAAGCATAATCCTAATATTAAGATTATCGCTGCCGACCCCCACGGTAGTATC
CTCGCCCAGCCTGACGAGCTCAACGGAGACCGTGCAAACGAGTCTTACAAGGTGGAGGGTATTGGCTACGACTTT
GTCCCCGACGTCCTCGACCGCGGCCTCGTCGACAAGTGGTACAAGACGGACGACGACGAGTCCTTCCGCCTCGCC
AGGCGTCTCATCTCCGAGGAGGGTCTCCTTGTCGGTGGCAGCTCCGGCTCCGCCATGGCCGCCATGCTGCGGGCC
GTCAAGGACCTCGACCTCGGAAGGGGCCAAATCGTCGTCGTCATCCTGCCCGACAGCATCCGGAGCTACCTGTCC
AAGTTTGCCGACGACGACTGGCTGGCCGCCAATGGCCTGTTGTCGAATGATGCCGTCAACGGCGCCGCCGACCCG
GGCTCCGTCCCCTCGGACCTCTCCGCCGCCGATCCCTACCGTGGAGCGACGGTGGCTTCCCTTCGGCTCAAGCCC
GTTACCTCGATCGACGCGGCCGCCACGTGCTCCGAGGCCATCGAGACGATGCGCGACAAGGGCTTCGACCAGCTG
CCCGTCCTATCCTCGTCACGCCTCGTCGGCCTCGTCACGCTCGGCAACCTGCTCAGCTACATCTCGCGCGGCCGG
GCCACGGGCCAGAGCGCGGTCCGCGACGTCATGTTCGACTTTGGCCGTCTGGACGAGGTGGTGACGGATCCGCGT
CAGGGAGCCGCTGGCCGCCGCTCCTCGTCGTCGAGGCGGAAGTTTGTCGAGATTACCATGGACACGCCCCTTTCG
GAACTCAGCAACTTTTTTGAGTGGAACAGCGCGGCCGTGGTGACGGAGAAGAGCGCAGACGGGGCAAAGTCGCTG
TCCAAGCCGGTTGCTATCGTGACAAAGGTCGATTTGTTGACGTGGATGGTCAACAGGAAGCTGTGA
Transcript >Ophun1|6055
ATGGCGACTCCTACGCTGCCGTTTGTCGGCCGCAAGCCGGCGACGGTGCTTTCGGCTTCGGATCTGATTGGGAAT
ACGCCGCTGGTGAGGCTCAACCGGGTGCCGCAGTCGCTGGGCGTCGAGTGTCAGGTCTATGTCAAGACGGAGATG
TTCAATGCTGGGGGGAGCGTCAAGGATCGCATTGCGCTGCGCATGGTCTTGGAGGCGGAACGCACTGGGAGGATA
AAGCCCGGGGATACGCTGATTGAGCCGACGAGCGGGAATACCGGCATCGGCCTCGCCCTCGTCGGCGCCATCAAG
GGCTACAAAACCATCATCACCATGCCCGAGAAAATGTCGGCCGAAAAAGTATCCGTCCTGCGCGCCCTCGGAGCC
ACCATCATCCGTACTCCCACCCAGGCCGCCTTCGACAGCCCCGAGTCGCACATCGGCGTCGCCCGTCGCTTGGAA
AAGGAGATGCCCAACGCCCACATCCTCGACCAGTACTCCAACCCCCACAACCCGCTTGCCCACGAGCTCGACACC
GCAGAGGAGATTTGGGAGCAGACGGGCGGCCGAGTCGATGCTGTCGTCGCCGGCGCCGGCACCGGAGGGACCATC
ACCGGCTTGGCCAGGGGTCTCCGGAAGCATAATCCTAATATTAAGATTATCGCTGCCGACCCCCACGGTAGTATC
CTCGCCCAGCCTGACGAGCTCAACGGAGACCGTGCAAACGAGTCTTACAAGGTGGAGGGTATTGGCTACGACTTT
GTCCCCGACGTCCTCGACCGCGGCCTCGTCGACAAGTGGTACAAGACGGACGACGACGAGTCCTTCCGCCTCGCC
AGGCGTCTCATCTCCGAGGAGGGTCTCCTTGTCGGTGGCAGCTCCGGCTCCGCCATGGCCGCCATGCTGCGGGCC
GTCAAGGACCTCGACCTCGGAAGGGGCCAAATCGTCGTCGTCATCCTGCCCGACAGCATCCGGAGCTACCTGTCC
AAGTTTGCCGACGACGACTGGCTGGCCGCCAATGGCCTGTTGTCGAATGATGCCGTCAACGGCGCCGCCGACCCG
GGCTCCGTCCCCTCGGACCTCTCCGCCGCCGATCCCTACCGTGGAGCGACGGTGGCTTCCCTTCGGCTCAAGCCC
GTTACCTCGATCGACGCGGCCGCCACGTGCTCCGAGGCCATCGAGACGATGCGCGACAAGGGCTTCGACCAGCTG
CCCGTCCTATCCTCGTCACGCCTCGTCGGCCTCGTCACGCTCGGCAACCTGCTCAGCTACATCTCGCGCGGCCGG
GCCACGGGCCAGAGCGCGGTCCGCGACGTCATGTTCGACTTTGGCCGTCTGGACGAGGTGGTGACGGATCCGCGT
CAGGGAGCCGCTGGCCGCCGCTCCTCGTCGTCGAGGCGGAAGTTTGTCGAGATTACCATGGACACGCCCCTTTCG
GAACTCAGCAACTTTTTTGAGTGGAACAGCGCGGCCGTGGTGACGGAGAAGAGCGCAGACGGGGCAAAGTCGCTG
TCCAAGCCGGTTGCTATCGTGACAAAGGTCGATTTGTTGACGTGGATGGTCAACAGGAAGCTGTGA
Gene >Ophun1|6055
ATGGCGACTCCTACGCTGCCGTTTGTCGGCCGCAAGCCGGCGACGGTGCTTTCGGCTTCGGATCTGATTGGGAAT
ACGCCGCTGGTGAGGCTCAACCGGGTGCCGCAGTCGCTGGGCGTCGAGTGTCAGGTCTATGTCAAGACGGAGATG
TTCAATGCTGGGGGGAGCGTCAAGGATCGCATTGCGCTGCGCATGGTCTTGGAGGCGGAACGCACTGGGAGGATA
AAGCCCGGGGATACGCTGATTGAGCCGACGAGCGGGAATACGTGAGTTGCCCGTGGTGGCGGATGAGAACAGTCC
GACGTCGACGGAGAGGAACAGGGAGAGAGAGAGCAAGAGAGAGCACTCAGCTAACTCCTCCCAGCGGCATCGGCC
TCGCCCTCGTCGGCGCCATCAAGGGCTACAAAACCATCATCACCATGCCCGAGAAAATGTCGGCCGAAAAAGTAT
CCGTCCTGCGCGCCCTCGGAGCCACCATCATCCGTACTCCCACCCAGGCCGCCTTCGACAGCCCCGAGTCGCACA
TCGGCGTCGCCCGTCGCTTGGAAAAGGAGATGCCCAACGCCCACATCCTCGACCAGTACTCCAACCCCCACAACC
CGCTTGCCCACGAGCTCGACACCGCAGAGGAGATTTGGGAGCAGACGGGCGGCCGAGTCGATGCTGTCGTCGCCG
GCGCCGGCACCGGAGGGACCATCACCGGCTTGGCCAGGGGTCTCCGGAAGCATAATCCTAATATTAAGATTATCG
CTGCCGACCCCCACGGTAGTATCCTCGCCCAGCCTGACGAGCTCAACGGAGACCGTGCAAACGAGTCTTACAAGG
TGGAGGGTATTGGCTACGACTTTGTCCCCGACGTCCTCGACCGCGGCCTCGTCGACAAGTGGTACAAGACGGACG
ACGACGAGTCCTTCCGCCTCGCCAGGCGTCTCATCTCCGAGGAGGGTCTCCTTGTCGGTGGCAGCTCCGGCTCCG
CCATGGCCGCCATGCTGCGGGCCGTCAAGGACCTCGACCTCGGAAGGGGCCAAATCGTCGTCGTCATCCTGCCCG
ACAGCATCCGGAGCTACCTGTCCAAGTTTGCCGACGACGACTGGCTGGCCGCCAATGGCCTGTTGTCGAATGATG
CCGTCAACGGCGCCGCCGACCCGGGCTCCGTCCCCTCGGACCTCTCCGCCGCCGATCCCTACCGTGGAGCGACGG
TGGCTTCCCTTCGGCTCAAGCCCGTTACCTCGATCGACGCGGCCGCCACGTGCTCCGAGGCCATCGAGACGATGC
GCGACAAGGGCTTCGACCAGCTGCCCGTCCTATCCTCGTCACGCCTCGTCGGCCTCGTCACGCTCGGCAACCTGC
TCAGCTACATCTCGCGCGGCCGGGCCACGGGCCAGAGCGCGGTCCGCGACGTCATGTTCGACTTTGGCCGTCTGG
ACGAGGTGGTGACGGATCCGCGTCAGGGAGCCGCTGGCCGCCGCTCCTCGTCGTCGAGGCGGAAGTTTGTCGAGA
TTACCATGGACACGCCCCTTTCGGAACTCAGCAACTTTTTTGAGTGGAACAGCGCGGCCGTGGTGACGGAGAAGA
GCGCAGACGGGGCAAAGTCGCTGTCCAAGCCGGTTGCTATCGTGACAAAGGTCGATTTGTTGACGTGGATGGTCA
ACAGGAAGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail