Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6051
Gene name
LocationContig_633:1578..2405
Strand+
Gene length (bp)827
Transcript length (bp)774
Coding sequence length (bp)774
Protein length (aa) 258

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04722 Ssu72 Ssu72-like protein 1.5E-86 27 257

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IPC8|SSU72_GIBZE RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SSU72 PE=3 SV=1 1 257 4.0E-157
sp|Q2HFZ9|SSU72_CHAGB RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SSU72 PE=3 SV=1 1 257 3.0E-149
sp|Q7SFY0|SSU72_NEUCR RNA polymerase II subunit A C-terminal domain phosphatase ssu-72 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ssu-72 PE=3 SV=1 1 257 7.0E-145
sp|Q2UPU5|SSU72_ASPOR RNA polymerase II subunit A C-terminal domain phosphatase ssu72 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ssu72 PE=3 SV=1 2 257 1.0E-127
sp|Q4WHY5|SSU72_ASPFU RNA polymerase II subunit A C-terminal domain phosphatase ssu72 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ssu72 PE=3 SV=1 3 257 9.0E-126
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IPC8|SSU72_GIBZE RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SSU72 PE=3 SV=1 1 257 4.0E-157
sp|Q2HFZ9|SSU72_CHAGB RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SSU72 PE=3 SV=1 1 257 3.0E-149
sp|Q7SFY0|SSU72_NEUCR RNA polymerase II subunit A C-terminal domain phosphatase ssu-72 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ssu-72 PE=3 SV=1 1 257 7.0E-145
sp|Q2UPU5|SSU72_ASPOR RNA polymerase II subunit A C-terminal domain phosphatase ssu72 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ssu72 PE=3 SV=1 2 257 1.0E-127
sp|Q4WHY5|SSU72_ASPFU RNA polymerase II subunit A C-terminal domain phosphatase ssu72 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ssu72 PE=3 SV=1 3 257 9.0E-126
sp|Q6C195|SSU72_YARLI RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SSU72 PE=3 SV=1 26 257 4.0E-69
sp|O42868|SSU72_SCHPO RNA polymerase II subunit A C-terminal domain phosphatase ssu72 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssu72 PE=1 SV=1 27 257 4.0E-69
sp|Q6CQ61|SSU72_KLULA RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SSU72 PE=3 SV=1 27 257 3.0E-62
sp|Q6FMU7|SSU72_CANGA RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SSU72 PE=3 SV=1 27 257 1.0E-61
sp|Q75E60|SSU72_ASHGO RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SSU72 PE=3 SV=1 18 257 4.0E-60
sp|P53538|SSU72_YEAST RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSU72 PE=1 SV=1 27 257 1.0E-59
sp|Q6BYP7|SSU72_DEBHA RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SSU72 PE=3 SV=2 27 257 8.0E-59
sp|P0CR76|SSU72_CRYNJ RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SSU72 PE=3 SV=1 47 206 1.0E-51
sp|P0CR77|SSU72_CRYNB RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SSU72 PE=3 SV=1 47 206 1.0E-51
sp|Q5ZJQ7|SSU72_CHICK RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Gallus gallus GN=SSU72 PE=2 SV=1 27 212 4.0E-50
sp|Q17QI2|SSU72_BOVIN RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Bos taurus GN=SSU72 PE=2 SV=1 27 212 1.0E-49
sp|Q9CY97|SSU72_MOUSE RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Mus musculus GN=Ssu72 PE=1 SV=1 27 212 2.0E-49
sp|Q9NP77|SSU72_HUMAN RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Homo sapiens GN=SSU72 PE=1 SV=1 27 212 2.0E-49
sp|Q4KLK9|SSU72_RAT RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Rattus norvegicus GN=Ssu72 PE=2 SV=1 27 212 2.0E-49
sp|Q6NRQ7|SSU72_XENLA RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Xenopus laevis GN=ssu72 PE=2 SV=1 27 212 1.0E-48
sp|Q6PC19|SSU72_DANRE RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Danio rerio GN=ssu72 PE=2 SV=1 27 212 2.0E-47
sp|Q558Z3|SSU72_DICDI RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Dictyostelium discoideum GN=ssu72 PE=3 SV=1 7 200 5.0E-40
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0004721 phosphoprotein phosphatase activity Yes
GO:0006397 mRNA processing Yes
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016791 phosphatase activity No
GO:0090304 nucleic acid metabolic process No
GO:0006396 RNA processing No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0043227 membrane-bounded organelle No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0043229 intracellular organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0043226 organelle No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016787 hydrolase activity No
GO:0016071 mRNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0042578 phosphoric ester hydrolase activity No
GO:0043231 intracellular membrane-bounded organelle No
GO:0016070 RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6051
MESVNGSSAAAASASNGSEDAPGSFKLKFCTVCASNQNRSMEAHLRLSQANYPVISFGTGSLVRLPGPTITQPNV
YQFNKTSYDSMYKELEAKDPRLYRNNGILNMLDRNREVKWGPERWQDWAVGLPRLQHVKDRGFEGTEGGVVDVVF
TCEERCWDAVIDDLLSRGSPLNRPVHVINVDIKDNHEEAHVGGQGILDLANSLNAAAVEEREAMGSATFDSGSAA
GRASFDERVPEILGAWQERWPHLPATWTLAWF*
Coding >Ophun1|6051
ATGGAGTCGGTCAACGGCTCTTCGGCGGCGGCAGCCTCGGCGTCAAACGGCTCTGAAGATGCGCCGGGCTCTTTC
AAGCTGAAATTCTGCACCGTCTGTGCCAGTAATCAGAATCGTTCCATGGAGGCCCATCTGCGGCTCTCCCAAGCC
AACTACCCCGTCATCTCCTTTGGCACCGGCTCCCTGGTGCGGCTGCCCGGGCCGACCATTACGCAGCCAAACGTC
TACCAATTCAACAAGACGTCGTACGACAGCATGTACAAGGAGCTCGAGGCCAAGGACCCGCGGCTGTATAGAAAC
AATGGCATCCTCAACATGCTGGACAGGAACAGAGAGGTCAAGTGGGGACCCGAGAGGTGGCAGGACTGGGCTGTC
GGTCTCCCGCGTCTGCAGCACGTCAAAGACCGCGGTTTCGAAGGCACCGAGGGCGGCGTCGTGGATGTCGTATTC
ACCTGTGAGGAACGCTGCTGGGACGCCGTCATCGACGACCTCCTGAGCAGGGGCTCCCCGCTGAACCGCCCTGTT
CATGTCATCAACGTCGATATCAAGGATAATCACGAAGAGGCTCATGTCGGTGGTCAGGGCATCCTCGACCTTGCC
AACTCGCTCAACGCCGCCGCCGTCGAGGAACGGGAAGCCATGGGCTCGGCAACGTTTGACAGCGGAAGCGCGGCG
GGCCGAGCCAGCTTTGACGAGCGAGTGCCGGAGATTCTGGGCGCCTGGCAGGAACGTTGGCCGCATCTTCCAGCG
ACGTGGACGCTGGCTTGGTTCTGA
Transcript >Ophun1|6051
ATGGAGTCGGTCAACGGCTCTTCGGCGGCGGCAGCCTCGGCGTCAAACGGCTCTGAAGATGCGCCGGGCTCTTTC
AAGCTGAAATTCTGCACCGTCTGTGCCAGTAATCAGAATCGTTCCATGGAGGCCCATCTGCGGCTCTCCCAAGCC
AACTACCCCGTCATCTCCTTTGGCACCGGCTCCCTGGTGCGGCTGCCCGGGCCGACCATTACGCAGCCAAACGTC
TACCAATTCAACAAGACGTCGTACGACAGCATGTACAAGGAGCTCGAGGCCAAGGACCCGCGGCTGTATAGAAAC
AATGGCATCCTCAACATGCTGGACAGGAACAGAGAGGTCAAGTGGGGACCCGAGAGGTGGCAGGACTGGGCTGTC
GGTCTCCCGCGTCTGCAGCACGTCAAAGACCGCGGTTTCGAAGGCACCGAGGGCGGCGTCGTGGATGTCGTATTC
ACCTGTGAGGAACGCTGCTGGGACGCCGTCATCGACGACCTCCTGAGCAGGGGCTCCCCGCTGAACCGCCCTGTT
CATGTCATCAACGTCGATATCAAGGATAATCACGAAGAGGCTCATGTCGGTGGTCAGGGCATCCTCGACCTTGCC
AACTCGCTCAACGCCGCCGCCGTCGAGGAACGGGAAGCCATGGGCTCGGCAACGTTTGACAGCGGAAGCGCGGCG
GGCCGAGCCAGCTTTGACGAGCGAGTGCCGGAGATTCTGGGCGCCTGGCAGGAACGTTGGCCGCATCTTCCAGCG
ACGTGGACGCTGGCTTGGTTCTGA
Gene >Ophun1|6051
ATGGAGTCGGTCAACGGCTCTTCGGCGGCGGCAGCCTCGGCGTCAAACGGCTCTGAAGATGCGCCGGGCTCTTTC
AAGCTGAAATTCTGCACCGTCTGTGCCAGTAATCAGAATCGGTAAGCCGGTCGCCCATTTCGTAGCCAGGTCAGG
TTGCTGACGACGACGTCAGTTCCATGGAGGCCCATCTGCGGCTCTCCCAAGCCAACTACCCCGTCATCTCCTTTG
GCACCGGCTCCCTGGTGCGGCTGCCCGGGCCGACCATTACGCAGCCAAACGTCTACCAATTCAACAAGACGTCGT
ACGACAGCATGTACAAGGAGCTCGAGGCCAAGGACCCGCGGCTGTATAGAAACAATGGCATCCTCAACATGCTGG
ACAGGAACAGAGAGGTCAAGTGGGGACCCGAGAGGTGGCAGGACTGGGCTGTCGGTCTCCCGCGTCTGCAGCACG
TCAAAGACCGCGGTTTCGAAGGCACCGAGGGCGGCGTCGTGGATGTCGTATTCACCTGTGAGGAACGCTGCTGGG
ACGCCGTCATCGACGACCTCCTGAGCAGGGGCTCCCCGCTGAACCGCCCTGTTCATGTCATCAACGTCGATATCA
AGGATAATCACGAAGAGGCTCATGTCGGTGGTCAGGGCATCCTCGACCTTGCCAACTCGCTCAACGCCGCCGCCG
TCGAGGAACGGGAAGCCATGGGCTCGGCAACGTTTGACAGCGGAAGCGCGGCGGGCCGAGCCAGCTTTGACGAGC
GAGTGCCGGAGATTCTGGGCGCCTGGCAGGAACGTTGGCCGCATCTTCCAGCGACGTGGACGCTGGCTTGGTTCT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail