Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6044
Gene name
LocationContig_631:144..1064
Strand-
Gene length (bp)920
Transcript length (bp)720
Coding sequence length (bp)720
Protein length (aa) 240

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9STX2|VEP1_ARATH 3-oxo-Delta(4,5)-steroid 5-beta-reductase OS=Arabidopsis thaliana GN=VEP1 PE=1 SV=1 7 237 2.0E-10
sp|Q6PQJ9|5BPOR_DIGLA 3-oxo-Delta(4,5)-steroid 5-beta-reductase OS=Digitalis lanata PE=1 SV=1 4 237 7.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6180
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02219
Ophiocordyceps camponoti-rufipedis Ophun1|6044 (this protein)
Ophiocordyceps kimflemingae Ophio5|3463
Ophiocordyceps subramaniannii Hirsu2|5512

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6044
MTDSNHALVFGATGLLGWAVTEQLLSGYPQPGAFSTVTAVVRRPETDLGLPSGGPAFRLVGGVDLLGSGADLTAR
LRDVPDVERTTHVFYYVFATCGEDEAREARVNGDMLLRVVEAVNAVAPRLVSFVFAGGTKQYGIWEPGGKMPAPL
RESLVENMQPEEMPSCVYPLHRQILTDASRGKGWVWTELCPDVVVGYSPFGADYSLALHWAQYLSLVAEREGEGT
RVPFPGCAEAYECD*
Coding >Ophun1|6044
ATGACCGACAGCAACCACGCCCTCGTCTTCGGAGCAACCGGTCTGCTGGGCTGGGCCGTAACCGAGCAGCTGCTA
TCCGGATACCCACAACCAGGAGCCTTCTCGACCGTCACCGCCGTCGTGCGCCGTCCGGAGACGGACCTCGGGCTC
CCGTCCGGCGGTCCGGCCTTCCGGCTGGTGGGCGGCGTCGACCTGCTGGGCAGCGGGGCCGATCTCACGGCGCGG
CTACGGGATGTCCCGGACGTGGAGCGGACGACGCATGTTTTCTACTACGTGTTTGCCACTTGTGGTGAGGATGAG
GCGAGGGAGGCGAGGGTTAATGGCGATATGCTGCTTCGTGTTGTCGAGGCTGTTAATGCTGTTGCTCCGCGGCTT
GTCAGCTTCGTCTTCGCAGGCGGGACCAAACAATACGGCATCTGGGAACCGGGCGGGAAGATGCCTGCTCCGCTC
CGAGAGTCGCTCGTCGAGAACATGCAGCCGGAGGAGATGCCCTCGTGCGTGTATCCGCTTCACCGGCAGATCCTA
ACCGACGCGAGCCGAGGGAAGGGCTGGGTCTGGACGGAGCTTTGTCCGGATGTGGTTGTTGGGTATAGCCCGTTT
GGAGCGGATTACTCGCTTGCGCTGCACTGGGCTCAGTATCTTTCGCTGGTGGCGGAGAGGGAGGGCGAGGGGACG
CGCGTGCCGTTCCCTGGATGTGCTGAGGCGTACGAGTGTGATTAA
Transcript >Ophun1|6044
ATGACCGACAGCAACCACGCCCTCGTCTTCGGAGCAACCGGTCTGCTGGGCTGGGCCGTAACCGAGCAGCTGCTA
TCCGGATACCCACAACCAGGAGCCTTCTCGACCGTCACCGCCGTCGTGCGCCGTCCGGAGACGGACCTCGGGCTC
CCGTCCGGCGGTCCGGCCTTCCGGCTGGTGGGCGGCGTCGACCTGCTGGGCAGCGGGGCCGATCTCACGGCGCGG
CTACGGGATGTCCCGGACGTGGAGCGGACGACGCATGTTTTCTACTACGTGTTTGCCACTTGTGGTGAGGATGAG
GCGAGGGAGGCGAGGGTTAATGGCGATATGCTGCTTCGTGTTGTCGAGGCTGTTAATGCTGTTGCTCCGCGGCTT
GTCAGCTTCGTCTTCGCAGGCGGGACCAAACAATACGGCATCTGGGAACCGGGCGGGAAGATGCCTGCTCCGCTC
CGAGAGTCGCTCGTCGAGAACATGCAGCCGGAGGAGATGCCCTCGTGCGTGTATCCGCTTCACCGGCAGATCCTA
ACCGACGCGAGCCGAGGGAAGGGCTGGGTCTGGACGGAGCTTTGTCCGGATGTGGTTGTTGGGTATAGCCCGTTT
GGAGCGGATTACTCGCTTGCGCTGCACTGGGCTCAGTATCTTTCGCTGGTGGCGGAGAGGGAGGGCGAGGGGACG
CGCGTGCCGTTCCCTGGATGTGCTGAGGCGTACGAGTGTGATTAA
Gene >Ophun1|6044
ATGACCGACAGCAACCACGCCCTCGTCTTCGGAGCAACCGGTCTGCTGGGCTGGGCCGTAACCGAGCAGCTGCTA
TCCGGATACCCACAACCAGGAGCCTTCTCGACCGTCACCGCCGTCGTGCGCCGTCCGGAGACGGACCTCGGGCTC
CCGTCCGGCGGTCCGGCCTTCCGGCTGGTGGGCGGCGTCGACCTGCTGGGCAGCGGGGCCGATCTCACGGCGCGG
CTACGGGATGTCCCGGACGTGGAGCGGACGACGCATGTTTTCTACTACGGTTCGGATGCTGGCTGTCTTGCTGTT
GCTGCTTGCTTATGGTGTTAGTGTTTGCCACTTGTGGTGAGGATGAGGCGAGGGAGGCGAGGGTTAATGGCGATA
TGCTGCTTCGTGTTGTCGAGGCTGTTAATGCTGTTGCTCCGCGGCTTGTCAGCTTCGTCTTCGCAGGCGGGACCA
AAGTAAGGACCTGATACTCCCCGTCTCCCTTCGACTATGGCTTAAATAGTAACCACACAGCAATACGGCATCTGG
GAACCGGGCGGGAAGATGCCTGCTCCGCTCCGAGAGTCGCTCGTCGAGAACATGCAGCCGGAGGAGATGCCCTCG
TGCGTGTATCCGCTTCACCGGCAGATCCTAACCGACGCGAGCCGAGGGAAGGGCTGGGTCTGGACGGAGCTTTGT
CCGGATGTGGTTGTTGGGTATAGCCCGTTTGGAGCGGATTACTCGCTTGCGCTGCACTGGGCTCAGTATCTTTCG
CTGGTGGCGGAGAGGGAGGGCGAGGGGACGCGCGTGCCGTTCCCTGGATGTGCTGAGGCGTACGAGTGTAAGTTT
TCGCCTGTTTCGGGGAGCATCTTGGGGAGGGCTTCTATATACATCGCTCTGCTTCACGGGCGGACGGGTGACGGC
TCGGCGGGAAAGGTGATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail