Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6035
Gene name
LocationContig_63:30921..33433
Strand-
Gene length (bp)2512
Transcript length (bp)2034
Coding sequence length (bp)2034
Protein length (aa) 678

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00425 Chorismate_bind chorismate binding enzyme 5.6E-80 372 649
PF04715 Anth_synt_I_N Anthranilate synthase component I, N terminal region 1.1E-19 179 310

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P00899|TRPE_YEAST Anthranilate synthase component 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRP2 PE=1 SV=4 145 662 0.0E+00
sp|O94582|TRPE_SCHPO Probable anthranilate synthase component 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trp3 PE=1 SV=1 145 664 0.0E+00
sp|Q9Z4W7|TRPE_STRCO Anthranilate synthase component 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trpE PE=3 SV=1 169 661 5.0E-100
sp|P14953|TRPE_CLOTM Anthranilate synthase component 1 OS=Clostridium thermocellum GN=trpE PE=3 SV=1 148 662 2.0E-98
sp|P20579|TRPE_PSEPU Anthranilate synthase component 1 OS=Pseudomonas putida GN=trpE PE=3 SV=1 170 662 1.0E-97
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P00899|TRPE_YEAST Anthranilate synthase component 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRP2 PE=1 SV=4 145 662 0.0E+00
sp|O94582|TRPE_SCHPO Probable anthranilate synthase component 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trp3 PE=1 SV=1 145 664 0.0E+00
sp|Q9Z4W7|TRPE_STRCO Anthranilate synthase component 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trpE PE=3 SV=1 169 661 5.0E-100
sp|P14953|TRPE_CLOTM Anthranilate synthase component 1 OS=Clostridium thermocellum GN=trpE PE=3 SV=1 148 662 2.0E-98
sp|P20579|TRPE_PSEPU Anthranilate synthase component 1 OS=Pseudomonas putida GN=trpE PE=3 SV=1 170 662 1.0E-97
sp|O66849|TRPE_AQUAE Anthranilate synthase component 1 OS=Aquifex aeolicus (strain VF5) GN=trpE PE=3 SV=1 157 662 3.0E-96
sp|Q9X7C5|TRPE_MYCLE Anthranilate synthase component 1 OS=Mycobacterium leprae (strain TN) GN=trpE PE=3 SV=1 169 661 6.0E-95
sp|P20580|TRPE_PSEAE Anthranilate synthase component 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trpE PE=1 SV=1 170 662 5.0E-94
sp|P30526|TRPE_BACCA Anthranilate synthase component 1 OS=Bacillus caldotenax GN=trpE PE=3 SV=1 170 664 1.0E-93
sp|P21689|TRPE_PSESS Anthranilate synthase component 1 OS=Pseudomonas savastanoi GN=trpE PE=3 SV=1 170 649 1.0E-93
sp|Q9S358|TRPE_NEIMF Anthranilate synthase component 1 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=trpE PE=3 SV=1 170 662 1.0E-91
sp|P56995|TRPE_NEIMB Anthranilate synthase component 1 OS=Neisseria meningitidis serogroup B (strain MC58) GN=trpE PE=3 SV=1 170 662 2.0E-91
sp|Q9XAZ0|TRPE_NEIMA Anthranilate synthase component 1 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=trpE PE=3 SV=1 170 662 3.0E-91
sp|P05378|TRPE_THET8 Anthranilate synthase component 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=trpE PE=3 SV=1 171 661 4.0E-91
sp|A0QX93|TRPE_MYCS2 Anthranilate synthase component 1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=trpE PE=1 SV=1 169 649 2.0E-90
sp|Q9X6J4|TRPE_GEOSE Anthranilate synthase component 1 OS=Geobacillus stearothermophilus GN=trpE PE=3 SV=1 164 669 1.0E-89
sp|P20170|TRPE_SYNY3 Anthranilate synthase component 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trpE PE=3 SV=2 168 657 2.0E-89
sp|Q9WW00|TRPE_NEIGO Anthranilate synthase component 1 OS=Neisseria gonorrhoeae GN=trpE PE=3 SV=1 170 662 2.0E-88
sp|Q5F8B4|TRPE_NEIG1 Anthranilate synthase component 1 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=trpE PE=3 SV=1 170 662 2.0E-88
sp|P9WFX3|TRPE_MYCTU Anthranilate synthase component 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trpE PE=1 SV=1 169 649 7.0E-87
sp|P9WFX2|TRPE_MYCTO Anthranilate synthase component 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trpE PE=1 SV=1 169 649 7.0E-87
sp|P67002|TRPE_MYCBO Anthranilate synthase component 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=trpE PE=3 SV=1 169 649 7.0E-87
sp|Q08653|TRPE_THEMA Anthranilate synthase component 1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=trpE PE=3 SV=2 175 662 2.0E-86
sp|A2XNK3|ASA1_ORYSI Anthranilate synthase alpha subunit 1, chloroplastic OS=Oryza sativa subsp. indica GN=ASA1 PE=3 SV=1 168 664 2.0E-85
sp|Q94GF1|ASA1_ORYSJ Anthranilate synthase alpha subunit 1, chloroplastic OS=Oryza sativa subsp. japonica GN=ASA1 PE=1 SV=1 168 664 3.0E-85
sp|P23315|TRPE_ACICA Anthranilate synthase component 1 OS=Acinetobacter calcoaceticus GN=trpE PE=3 SV=1 170 657 3.0E-85
sp|P03963|TRPE_BACSU Anthranilate synthase component 1 OS=Bacillus subtilis (strain 168) GN=trpE PE=3 SV=2 170 665 6.0E-84
sp|P32069|TRPX_ARATH Anthranilate synthase alpha subunit 2, chloroplastic OS=Arabidopsis thaliana GN=ASA2 PE=2 SV=1 148 664 3.0E-83
sp|P32068|TRPE_ARATH Anthranilate synthase alpha subunit 1, chloroplastic OS=Arabidopsis thaliana GN=ASA1 PE=1 SV=1 148 664 9.0E-83
sp|P96556|TRPE_ARTGO Anthranilate synthase component 1 OS=Arthrobacter globiformis GN=trpE PE=3 SV=1 146 660 1.0E-82
sp|Q9XJ29|ASA2_ORYSJ Anthranilate synthase alpha subunit 2, chloroplastic OS=Oryza sativa subsp. japonica GN=OsASA2 PE=1 SV=1 162 664 1.0E-79
sp|P95646|TRPE_RHOS4 Anthranilate synthase component 1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=trpE PE=3 SV=3 172 649 4.0E-79
sp|Q02001|TRPE_LACLA Anthranilate synthase component 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=trpE PE=3 SV=2 174 649 4.0E-79
sp|Q58475|TRPE_METJA Anthranilate synthase component 1 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=trpE PE=3 SV=1 198 659 7.0E-78
sp|P18267|TRPE_BACPU Anthranilate synthase component 1 OS=Bacillus pumilus GN=trpE PE=3 SV=2 170 661 7.0E-77
sp|P21690|TRPE_SPIAU Anthranilate synthase component 1 OS=Spirochaeta aurantia GN=trpE PE=3 SV=1 260 657 5.0E-75
sp|P28820|PABB_BACSU Aminodeoxychorismate synthase component 1 OS=Bacillus subtilis (strain 168) GN=pabB PE=1 SV=1 187 662 5.0E-75
sp|Q5V213|TRPE2_HALMA Anthranilate synthase component 1 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpE2 PE=3 SV=1 166 661 2.0E-74
sp|P33975|TRPE_HALVD Anthranilate synthase component 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=trpE PE=3 SV=2 171 657 1.0E-72
sp|Q44695|TRPE_BUCAI Anthranilate synthase component 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trpE PE=3 SV=3 267 660 2.0E-64
sp|O27692|TRPE_METTH Anthranilate synthase component 1 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=trpE PE=3 SV=1 197 660 1.0E-63
sp|Q9HPG5|TRPE1_HALSA Anthranilate synthase component 1 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=trpE1 PE=3 SV=1 171 657 1.0E-63
sp|Q06128|TRPE_SULSO Anthranilate synthase component 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=trpE PE=1 SV=2 236 652 6.0E-63
sp|P26940|TRPE_METTM Anthranilate synthase component 1 OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=trpE PE=3 SV=2 195 663 4.0E-62
sp|P43761|TRPE_HAEIN Anthranilate synthase component 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trpE PE=3 SV=1 267 657 8.0E-62
sp|Q44697|TRPE_BUCDN Anthranilate synthase component 1 OS=Buchnera aphidicola subsp. Diuraphis noxia GN=trpE PE=3 SV=1 267 667 9.0E-62
sp|O28669|TRPE_ARCFU Anthranilate synthase component 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=trpE PE=3 SV=1 188 657 7.0E-61
sp|P42387|TRPE_BUCAP Anthranilate synthase component 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trpE PE=3 SV=1 368 664 2.0E-60
sp|Q9YGB3|TRPE_THEKO Anthranilate synthase component 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=trpE PE=3 SV=1 188 661 3.0E-60
sp|Q44689|TRPE_BUCRM Anthranilate synthase component 1 OS=Buchnera aphidicola subsp. Rhopalosiphum maidis GN=trpE PE=3 SV=1 267 664 4.0E-60
sp|P74130|TRE2_SYNY3 Anthranilate synthase component I-like protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trpE2 PE=3 SV=1 210 652 5.0E-60
sp|P00898|TRPE_SALTY Anthranilate synthase component 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trpE PE=1 SV=3 267 669 8.0E-60
sp|P22099|TRPE_VIBPA Anthranilate synthase component 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=trpE PE=3 SV=2 267 660 2.0E-59
sp|Q44691|TRPE_BUCRP Anthranilate synthase component 1 OS=Buchnera aphidicola subsp. Rhopalosiphum padi GN=trpE PE=3 SV=1 267 664 7.0E-59
sp|Q89A29|TRPE_BUCBP Anthranilate synthase component 1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trpE PE=3 SV=1 267 660 9.0E-59
sp|P00895|TRPE_ECOLI Anthranilate synthase component 1 OS=Escherichia coli (strain K12) GN=trpE PE=1 SV=2 366 669 1.0E-58
sp|Q9ZER9|TRPE_BUCPS Anthranilate synthase component 1 OS=Buchnera aphidicola subsp. Pemphigus spyrothecae GN=trpE PE=3 SV=1 267 660 2.0E-58
sp|Q5V631|TRPE3_HALMA Anthranilate synthase component 1 3 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpE3 PE=3 SV=2 168 660 7.0E-58
sp|Q44598|TRPE_BUCSC Anthranilate synthase component 1 OS=Buchnera aphidicola subsp. Schlechtendalia chinensis GN=trpE PE=3 SV=1 267 668 2.0E-57
sp|Q5V448|TRPE1_HALMA Anthranilate synthase component 1 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpE1 PE=3 SV=1 260 660 4.0E-57
sp|Q9KST2|TRPE_VIBCH Anthranilate synthase component 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=trpE PE=3 SV=1 368 662 1.0E-56
sp|P12680|PABB_SALTY Aminodeoxychorismate synthase component 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pabB PE=3 SV=1 236 651 1.0E-56
sp|P12679|PABB_ENTAE Aminodeoxychorismate synthase component 1 OS=Enterobacter aerogenes GN=pabB PE=3 SV=1 195 659 1.0E-55
sp|O25869|TRPE_HELPY Anthranilate synthase component 1 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trpE PE=3 SV=1 260 657 3.0E-55
sp|P06557|TRPE_CORGL Anthranilate synthase component 1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=trpE PE=3 SV=2 258 660 3.0E-55
sp|Q9ZES2|TRPE_BUCTC Anthranilate synthase component 1 OS=Buchnera aphidicola subsp. Tetraneura caerulescens GN=trpE PE=3 SV=1 267 657 5.0E-55
sp|P09785|PHNA_PSEAE Anthranilate synthase component 1, pyocyanine specific OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=phnA PE=1 SV=2 238 649 2.0E-54
sp|Q9ZJU5|TRPE_HELPJ Anthranilate synthase component 1 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trpE PE=3 SV=1 375 657 7.0E-54
sp|P00897|TRPE_SERMA Anthranilate synthase component 1 OS=Serratia marcescens GN=trpE PE=1 SV=2 267 669 2.0E-53
sp|P20463|TRPE_LEPBI Anthranilate synthase component 1 OS=Leptospira biflexa GN=trpE PE=3 SV=1 198 652 2.0E-53
sp|Q9Y8T0|TRPE_AERPE Anthranilate synthase component 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=trpE PE=3 SV=2 372 652 4.0E-52
sp|P05041|PABB_ECOLI Aminodeoxychorismate synthase component 1 OS=Escherichia coli (strain K12) GN=pabB PE=1 SV=1 182 651 4.0E-52
sp|Q9HS66|TRPE2_HALSA Anthranilate synthase component 1 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=trpE2 PE=3 SV=1 200 660 1.0E-51
sp|Q8LPN3|ADCS_ARATH Aminodeoxychorismate synthase, chloroplastic OS=Arabidopsis thaliana GN=ADCS PE=1 SV=1 261 652 2.0E-48
sp|Q8GMH4|SGCD_STRGL 2-amino-4-deoxychorismate synthase OS=Streptomyces globisporus GN=sgcD PE=1 SV=1 373 661 5.0E-47
sp|Q6TAS3|ADCS_SOLLC Aminodeoxychorismate synthase, chloroplastic OS=Solanum lycopersicum GN=ADCS PE=2 SV=1 293 657 1.0E-45
sp|P27630|PABB_STRLI Aminodeoxychorismate synthase component 1 OS=Streptomyces lividans GN=pabB PE=3 SV=1 261 649 2.0E-45
sp|P27629|PABB_LACLL Aminodeoxychorismate synthase component 1 OS=Lactococcus lactis subsp. lactis GN=pabB PE=3 SV=1 261 652 4.0E-44
sp|Q5Z856|ADCS_ORYSJ Probable aminodeoxychorismate synthase, chloroplastic OS=Oryza sativa subsp. japonica GN=ADCS PE=2 SV=1 263 666 1.0E-43
sp|P32483|PABS_STRGR Para-aminobenzoate synthase OS=Streptomyces griseus GN=pab PE=3 SV=1 372 660 1.0E-43
sp|P50872|TRPE_AZOBR Anthranilate synthase OS=Azospirillum brasilense GN=trpE(G) PE=3 SV=1 264 657 9.0E-41
sp|P15395|TRPE_RHIME Anthranilate synthase OS=Rhizobium meliloti (strain 1021) GN=trpE(G) PE=3 SV=1 375 661 7.0E-38
sp|Q51508|PCHA_PSEAE Salicylate biosynthesis isochorismate synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pchA PE=1 SV=1 372 659 2.0E-27
sp|O94277|PABS_SCHPO Putative aminodeoxychorismate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.29 PE=3 SV=1 366 649 5.0E-26
sp|Q73XV3|MBTI_MYCPA Salicylate synthase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtI PE=3 SV=1 375 650 8.0E-25
sp|Q57527|Y1170_HAEIN Uncharacterized PabA-like protein HI_1170 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1170 PE=4 SV=1 375 650 3.0E-20
sp|Q9CKY6|Y1464_PASMU Uncharacterized PabA-like protein PM1464 OS=Pasteurella multocida (strain Pm70) GN=PM1464 PE=4 SV=1 370 650 7.0E-19
sp|P37254|PABS_YEAST Aminodeoxychorismate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABZ1 PE=1 SV=4 375 655 2.0E-18
sp|P9WFW9|MENF_MYCTU Putative isochorismate synthase MenF OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=menF PE=1 SV=1 399 657 5.0E-18
sp|P9WFW8|MENF_MYCTO Putative isochorismate synthase MenF OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=menF PE=3 SV=1 399 657 5.0E-18
sp|Q9M9V6|ICS2_ARATH Isochorismate synthase 2, chloroplastic OS=Arabidopsis thaliana GN=ICS2 PE=2 SV=2 464 668 4.0E-17
sp|Q9ZPC0|ICS_CATRO Isochorismate synthase, chloroplastic OS=Catharanthus roseus PE=1 SV=1 464 645 6.0E-17
sp|Q9S7H8|ICS1_ARATH Isochorismate synthase 1, chloroplastic OS=Arabidopsis thaliana GN=ICS1 PE=1 SV=2 464 657 1.0E-16
sp|P9WFX1|MBTI_MYCTU Salicylate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtI PE=1 SV=1 319 650 2.0E-16
sp|P9WFX0|MBTI_MYCTO Salicylate synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtI PE=3 SV=1 319 650 2.0E-16
sp|Q7TYQ1|MBTI_MYCBO Salicylate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtI PE=3 SV=1 319 650 2.0E-16
sp|P23973|MENF_BACSU Isochorismate synthase MenF OS=Bacillus subtilis (strain 168) GN=menF PE=3 SV=2 421 650 2.0E-16
sp|P45744|DHBC_BACSU Isochorismate synthase DhbC OS=Bacillus subtilis (strain 168) GN=dhbC PE=1 SV=2 373 657 2.0E-15
sp|P38051|MENF_ECOLI Isochorismate synthase MenF OS=Escherichia coli (strain K12) GN=menF PE=1 SV=4 326 649 8.0E-12
sp|P23300|AMOA_AERHY Putative isochorismate synthase OS=Aeromonas hydrophila GN=amoA PE=3 SV=1 315 657 4.0E-11
sp|O07898|VIBC_VIBCH Vibriobactin-specific isochorismate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibC PE=3 SV=1 398 660 5.0E-10
sp|P44613|MENF_HAEIN Isochorismate synthase MenF OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=menF PE=3 SV=1 386 645 2.0E-09
sp|P0AEJ2|ENTC_ECOLI Isochorismate synthase EntC OS=Escherichia coli (strain K12) GN=entC PE=1 SV=1 411 657 1.0E-08
sp|P0AEJ3|ENTC_ECO57 Isochorismate synthase EntC OS=Escherichia coli O157:H7 GN=entC PE=3 SV=1 411 657 1.0E-08
sp|Q9CPI5|MENF_PASMU Isochorismate synthase MenF OS=Pasteurella multocida (strain Pm70) GN=menF PE=3 SV=1 386 634 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6035
MAFLDKANKDLGEGQAAAQRGGDTKFSFKAVDEDSAVPTSIRDVCKKEVYVSDADEPFVEVSLRWTGEGGLPNEV
EFAKLIRHWEAASAKIDIMDPAEWDPKGRYGAVVEAVREASRGNDNGGRGEWQQEENKTEELTLSHHPQQLEPSL
DTVRSIIQRPRRSGRRPTLVPVYRQMSSDLLTPSAAYLKLTASRSSSEYSFLFESAATEQVGRWSFVGAGPRKVL
TTGPGFGPETDPLPGLEAELAREVVADVPGLRLPPLTGGAIGYVGYDCVRYFEPKTAGPVVRDVLGIPESLFMLF
DSVVAFDRYYGVIKVIGYVRVSDDGSDLEEAYGKAKKAVDDLVDVLDAPGGVETPRQPTVHLGRTAQSNIGREGY
EAHVRRLKGHIKRGDIFQAVPSQRLSRPTDLHAFNIYRHLRTVNPSPYLFYLDCRDFCIVGASPELLVKTEMDPD
GLDDEDPSPRRPRVLTHPIAGTVLRGSSTAEDARLASELRASLKDRAEHVMLVDLARNDINRVCDPRTVRVDRLM
EVEKFSHVQHLVSQVSGLLRSEKTRFDAFRSVFPAGTVSGAPKVRAMELIATLEGEKRGVYAGAVGYFGYLVEGG
DGEVVDGAMDTCIALRTMVVKDGVAYLQAGGGIVFDSDEGDEYQETINKLGANMQCIASAEEHYHHLQQRQTADG
KQ*
Coding >Ophun1|6035
ATGGCGTTCCTTGACAAGGCGAACAAGGACCTGGGCGAGGGCCAGGCGGCGGCGCAGCGCGGCGGCGACACCAAG
TTCTCTTTCAAGGCCGTCGACGAGGACAGCGCGGTTCCGACGTCGATCCGAGATGTGTGCAAGAAGGAAGTGTAC
GTGAGCGATGCCGACGAGCCGTTCGTCGAGGTTTCGCTTCGCTGGACGGGGGAGGGAGGCTTACCGAACGAGGTC
GAGTTTGCCAAGCTGATTCGGCACTGGGAGGCGGCGTCGGCCAAGATTGACATAATGGATCCGGCCGAGTGGGAT
CCCAAGGGCCGGTATGGCGCTGTGGTCGAGGCTGTTCGGGAGGCGAGCCGTGGCAACGATAATGGCGGTCGCGGT
GAGTGGCAGCAGGAGGAAAACAAGACGGAAGAGCTGACCCTAAGCCACCACCCTCAGCAACTGGAACCGTCGCTC
GACACGGTTCGCAGCATCATCCAACGGCCGCGACGCAGTGGACGACGACCTACGCTGGTTCCCGTATACCGCCAG
ATGTCCTCGGACCTCCTCACGCCATCAGCAGCCTACCTCAAGCTCACAGCCTCGCGCTCCTCTTCCGAGTACTCG
TTCCTCTTCGAGTCGGCGGCAACGGAGCAGGTCGGACGCTGGAGCTTCGTGGGCGCGGGTCCTCGCAAGGTGCTG
ACGACGGGACCGGGCTTCGGACCGGAAACAGATCCGCTGCCGGGCCTCGAGGCCGAACTGGCGCGCGAAGTCGTG
GCTGACGTTCCGGGTCTGCGACTTCCGCCGCTGACGGGGGGGGCCATTGGATATGTTGGCTATGATTGCGTGCGG
TACTTTGAGCCTAAGACGGCGGGGCCGGTGGTTAGGGATGTGTTGGGGATTCCGGAGTCGTTGTTTATGTTGTTT
GATTCGGTGGTTGCTTTCGATCGGTACTACGGCGTCATCAAGGTTATCGGCTATGTTCGCGTCTCGGATGATGGC
TCGGATCTGGAAGAGGCTTACGGAAAGGCGAAGAAGGCGGTTGATGATCTCGTCGACGTCCTCGACGCACCAGGC
GGAGTCGAAACACCTCGACAACCAACCGTCCACCTCGGCCGCACCGCTCAATCCAACATCGGAAGAGAAGGATAC
GAAGCTCACGTTCGACGCCTCAAGGGCCACATCAAACGAGGCGACATCTTCCAAGCCGTTCCCTCACAGCGCCTC
TCTCGACCTACAGACCTGCACGCCTTCAACATCTACCGCCATCTGCGGACGGTGAACCCTTCGCCGTACCTCTTC
TACCTCGACTGCCGCGACTTTTGCATCGTCGGCGCGTCGCCCGAGTTGTTGGTCAAGACGGAGATGGACCCGGAT
GGTCTTGACGATGAGGATCCTTCTCCTCGTCGTCCCCGTGTCCTCACCCATCCCATCGCCGGCACCGTCCTCCGC
GGATCCTCAACAGCCGAAGACGCCCGTCTAGCCTCGGAACTACGCGCCTCGTTAAAAGACCGAGCCGAACACGTC
ATGCTCGTCGACTTGGCCCGCAACGACATCAACCGCGTGTGCGACCCGCGGACGGTACGGGTAGACCGACTGATG
GAAGTTGAAAAGTTCAGCCACGTGCAGCACCTCGTCTCCCAAGTCTCAGGCCTGCTCCGGAGCGAAAAGACGCGC
TTCGACGCCTTTCGCTCCGTCTTTCCCGCGGGGACCGTCTCCGGCGCGCCAAAGGTCAGGGCCATGGAGCTCATT
GCTACGCTCGAGGGGGAGAAGAGGGGGGTTTATGCTGGGGCCGTGGGGTATTTCGGCTATCTCGTTGAGGGGGGG
GATGGGGAGGTTGTTGATGGTGCCATGGATACGTGTATTGCCTTGAGGACCATGGTTGTGAAAGATGGGGTTGCT
TACCTTCAGGCTGGGGGAGGCATCGTCTTCGACTCAGACGAAGGCGACGAATACCAAGAAACCATCAACAAACTC
GGCGCAAACATGCAATGCATCGCCTCAGCAGAGGAGCACTACCACCACCTCCAACAGCGTCAGACGGCAGATGGG
AAGCAGTAA
Transcript >Ophun1|6035
ATGGCGTTCCTTGACAAGGCGAACAAGGACCTGGGCGAGGGCCAGGCGGCGGCGCAGCGCGGCGGCGACACCAAG
TTCTCTTTCAAGGCCGTCGACGAGGACAGCGCGGTTCCGACGTCGATCCGAGATGTGTGCAAGAAGGAAGTGTAC
GTGAGCGATGCCGACGAGCCGTTCGTCGAGGTTTCGCTTCGCTGGACGGGGGAGGGAGGCTTACCGAACGAGGTC
GAGTTTGCCAAGCTGATTCGGCACTGGGAGGCGGCGTCGGCCAAGATTGACATAATGGATCCGGCCGAGTGGGAT
CCCAAGGGCCGGTATGGCGCTGTGGTCGAGGCTGTTCGGGAGGCGAGCCGTGGCAACGATAATGGCGGTCGCGGT
GAGTGGCAGCAGGAGGAAAACAAGACGGAAGAGCTGACCCTAAGCCACCACCCTCAGCAACTGGAACCGTCGCTC
GACACGGTTCGCAGCATCATCCAACGGCCGCGACGCAGTGGACGACGACCTACGCTGGTTCCCGTATACCGCCAG
ATGTCCTCGGACCTCCTCACGCCATCAGCAGCCTACCTCAAGCTCACAGCCTCGCGCTCCTCTTCCGAGTACTCG
TTCCTCTTCGAGTCGGCGGCAACGGAGCAGGTCGGACGCTGGAGCTTCGTGGGCGCGGGTCCTCGCAAGGTGCTG
ACGACGGGACCGGGCTTCGGACCGGAAACAGATCCGCTGCCGGGCCTCGAGGCCGAACTGGCGCGCGAAGTCGTG
GCTGACGTTCCGGGTCTGCGACTTCCGCCGCTGACGGGGGGGGCCATTGGATATGTTGGCTATGATTGCGTGCGG
TACTTTGAGCCTAAGACGGCGGGGCCGGTGGTTAGGGATGTGTTGGGGATTCCGGAGTCGTTGTTTATGTTGTTT
GATTCGGTGGTTGCTTTCGATCGGTACTACGGCGTCATCAAGGTTATCGGCTATGTTCGCGTCTCGGATGATGGC
TCGGATCTGGAAGAGGCTTACGGAAAGGCGAAGAAGGCGGTTGATGATCTCGTCGACGTCCTCGACGCACCAGGC
GGAGTCGAAACACCTCGACAACCAACCGTCCACCTCGGCCGCACCGCTCAATCCAACATCGGAAGAGAAGGATAC
GAAGCTCACGTTCGACGCCTCAAGGGCCACATCAAACGAGGCGACATCTTCCAAGCCGTTCCCTCACAGCGCCTC
TCTCGACCTACAGACCTGCACGCCTTCAACATCTACCGCCATCTGCGGACGGTGAACCCTTCGCCGTACCTCTTC
TACCTCGACTGCCGCGACTTTTGCATCGTCGGCGCGTCGCCCGAGTTGTTGGTCAAGACGGAGATGGACCCGGAT
GGTCTTGACGATGAGGATCCTTCTCCTCGTCGTCCCCGTGTCCTCACCCATCCCATCGCCGGCACCGTCCTCCGC
GGATCCTCAACAGCCGAAGACGCCCGTCTAGCCTCGGAACTACGCGCCTCGTTAAAAGACCGAGCCGAACACGTC
ATGCTCGTCGACTTGGCCCGCAACGACATCAACCGCGTGTGCGACCCGCGGACGGTACGGGTAGACCGACTGATG
GAAGTTGAAAAGTTCAGCCACGTGCAGCACCTCGTCTCCCAAGTCTCAGGCCTGCTCCGGAGCGAAAAGACGCGC
TTCGACGCCTTTCGCTCCGTCTTTCCCGCGGGGACCGTCTCCGGCGCGCCAAAGGTCAGGGCCATGGAGCTCATT
GCTACGCTCGAGGGGGAGAAGAGGGGGGTTTATGCTGGGGCCGTGGGGTATTTCGGCTATCTCGTTGAGGGGGGG
GATGGGGAGGTTGTTGATGGTGCCATGGATACGTGTATTGCCTTGAGGACCATGGTTGTGAAAGATGGGGTTGCT
TACCTTCAGGCTGGGGGAGGCATCGTCTTCGACTCAGACGAAGGCGACGAATACCAAGAAACCATCAACAAACTC
GGCGCAAACATGCAATGCATCGCCTCAGCAGAGGAGCACTACCACCACCTCCAACAGCGTCAGACGGCAGATGGG
AAGCAGTAA
Gene >Ophun1|6035
ATGGCGTTCCTTGACAAGGCGAACAAGGACCTGGGCGAGGGCCAGGCGGCGGCGCAGCGCGGCGGCGACACCAAG
TTCTCTTTCAAGGCCGTCGACGAGGACAGCGCGGTTCCGACGTCGATCCGAGATGTGTGCAAGAAGGAAGTGTAC
GTGAGCGATGCCGACGAGCCGTTCGTCGAGGTTTCGCTTCGCTGGACGGGGGAGGGAGGCTTACCGAACGAGGGT
AAGGACATGTTTCCACCTTGATCAGACAACGAGGGGCTCTAACTGATACGGCCACGGCAGTCGAGTTTGCCAAGC
TGATTCGGCACTGGGAGGCGGCGTCGGCCAAGATTGACATAATGGATCCGGCCGAGTGGGATCCCAAGGGCCGGT
ATGGCGCTGTGGTCGAGGCTGTTCGGGAGGCGAGCCGTGGCAACGATGTGAGGGTTTACCGGGTGGTGAGAGATC
AGACGAGGGCCGAGTACTGGGTTGTTTCGAGGGACGGGGATCGGATTGTAGGGGCCAAGGCGCTGGGGGTGGAGA
GCTGAAGCCACGGACGAAGCCATCGTCAAAGGGGTATCCGTCGGCCGGACAAGGTTAAGCGGGTGGGTATAGGGT
AGCTGGCTAGCTCGAGCTGGTGCTGGACTGTGGCCCCACCAGCGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGG
TCTGAGAGCGAGAGCGAGCTATAACCGAGCGAAGCAATTACCGCACCCCGTCACGGACCGTCATCCAGCATCCTT
ATCCCATCGGAAGACGAGATTCAGGCAGAATGGCGGTCGCGGTGAGTGGCAGCAGGAGGAAAACAAGACGGAAGA
GCTGACCCTAAGCCACCACCCTCAGCAACTGGAACCGTCGCTCGACACGGTTCGCAGCATCATCCAACGGCCGCG
ACGCAGTGGACGACGACCTACGCTGGTTCCCGTATACCGCCAGATGTCCTCGGACCTCCTCACGCCATCAGCAGC
CTACCTCAAGCTCACAGCCTCGCGCTCCTCTTCCGAGTACTCGTTCCTCTTCGAGTCGGCGGCAACGGAGCAGGT
CGGACGCTGGAGCTTCGTGGGCGCGGGTCCTCGCAAGGTGCTGACGACGGGACCGGGCTTCGGACCGGAAACAGA
TCCGCTGCCGGGCCTCGAGGCCGAACTGGCGCGCGAAGTCGTGGCTGACGTTCCGGGTCTGCGACTTCCGCCGCT
GACGGGGGGGGCCATTGGATATGTTGGCTATGATTGCGTGCGGTACTTTGAGCCTAAGACGGCGGGGCCGGTGGT
TAGGGATGTGTTGGGGATTCCGGAGTCGTTGTTTATGTTGTTTGATTCGGTGGTTGCTTTCGATCGGTACTACGG
CGTCATCAAGGTTATCGGCTATGTTCGCGTCTCGGATGATGGCTCGGATCTGGAAGAGGCTTACGGAAAGGCGAA
GAAGGCGGTTGATGATCTCGTCGACGTCCTCGACGCACCAGGCGGAGTCGAAACACCTCGACAACCAACCGTCCA
CCTCGGCCGCACCGCTCAATCCAACATCGGAAGAGAAGGATACGAAGCTCACGTTCGACGCCTCAAGGGCCACAT
CAAACGAGGCGACATCTTCCAAGCCGTTCCCTCACAGCGCCTCTCTCGACCTACAGACCTGCACGCCTTCAACAT
CTACCGCCATCTGCGGACGGTGAACCCTTCGCCGTACCTCTTCTACCTCGACTGCCGCGACTTTTGCATCGTCGG
CGCGTCGCCCGAGTTGTTGGTCAAGACGGAGATGGACCCGGATGGTCTTGACGATGAGGATCCTTCTCCTCGTCG
TCCCCGTGTCCTCACCCATCCCATCGCCGGCACCGTCCTCCGCGGATCCTCAACAGCCGAAGACGCCCGTCTAGC
CTCGGAACTACGCGCCTCGTTAAAAGACCGAGCCGAACACGTCATGCTCGTCGACTTGGCCCGCAACGACATCAA
CCGCGTGTGCGACCCGCGGACGGTACGGGTAGACCGACTGATGGAAGTTGAAAAGTTCAGCCACGTGCAGCACCT
CGTCTCCCAAGTCTCAGGCCTGCTCCGGAGCGAAAAGACGCGCTTCGACGCCTTTCGCTCCGTCTTTCCCGCGGG
GACCGTCTCCGGCGCGCCAAAGGTCAGGGCCATGGAGCTCATTGCTACGCTCGAGGGGGAGAAGAGGGGGGTTTA
TGCTGGGGCCGTGGGGTATTTCGGCTATCTCGTTGAGGGGGGGGATGGGGAGGTTGTTGATGGTGCCATGGATAC
GTGTATTGCCTTGAGGACCATGGTTGTGAAAGATGGGGTTGCTTACCTTCAGGCTGGTGAGTTTCATCTCTCTTT
GTTGCGTCTTGTGTTGCTCAGATGCTTACTTCTTTTCGCAGGGGGAGGCATCGTCTTCGACTCAGACGAAGGCGA
CGAATACCAAGAAACCATCAACAAACTCGGCGCAAACATGCAATGCATCGCCTCAGCAGAGGAGCACTACCACCA
CCTCCAACAGCGTCAGACGGCAGATGGGAAGCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail