Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6034
Gene name
LocationContig_63:28908..30421
Strand+
Gene length (bp)1513
Transcript length (bp)1191
Coding sequence length (bp)1191
Protein length (aa) 397

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1975
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5611
Ophiocordyceps australis map64 (Brazil) OphauB2|3256
Ophiocordyceps camponoti-floridani Ophcf2|06662
Ophiocordyceps camponoti-rufipedis Ophun1|6034 (this protein)
Ophiocordyceps kimflemingae Ophio5|6204
Ophiocordyceps subramaniannii Hirsu2|217

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6034
MQRSFDDDLKLDSSENPFMAQQQCSGGMKRPRLSLQITTTSRTGRAVSVETSSSEPLTAINTLRCFSLDTPTEDK
TVVSRAITPYVASYPETPLTAQPTSPSQLEVHYYSDTMTATPPLSADAGPSSFTFGSDDDDDDDDDDDDSSRSLP
VVAGDVRPPYSHPRSLHSILRNSPLPPPTAIPPPSPRRQSLRLQEKAAKKVGYNSPLTQEIVTNQYTKSHMELLD
EDTSPSSPQRTTTVEPDAHAQDQSRPALPSTAEKDQAGTTGESTAWYRKRRQTEKKRRWVWTIGQDEEDDESPIP
VPQESTADTTTTPTPTASLEGSSADTESASSSALASAVDASASDTCSLDWTDDEQHAEGESGPEAKTPTSTRRLD
GAVVQRDTPVPELLPSRGMSV*
Coding >Ophun1|6034
ATGCAACGAAGCTTCGACGACGACCTCAAGCTGGACTCATCAGAGAATCCCTTCATGGCTCAGCAGCAGTGTTCC
GGCGGCATGAAGAGGCCCAGGCTGTCTCTTCAGATCACGACTACTTCGCGGACGGGTCGGGCCGTGAGCGTCGAG
ACGTCTTCTTCTGAGCCGCTGACGGCCATCAACACGCTGCGATGCTTCAGTCTCGATACGCCAACCGAGGACAAG
ACGGTCGTTTCCCGGGCCATCACGCCCTACGTCGCCTCGTACCCGGAGACCCCCCTGACAGCACAGCCCACGTCG
CCCTCACAGCTGGAAGTGCACTACTATTCCGACACCATGACGGCCACGCCTCCGCTCTCGGCCGACGCGGGGCCG
TCCTCCTTTACCTTTGGCTCCGACGACGACGACGACGACGACGACGACGACGACGATAGCTCCCGGTCACTCCCG
GTCGTGGCCGGTGACGTCCGTCCTCCGTATTCACACCCGCGGAGCTTGCACAGCATTCTTCGCAACTCTCCGCTT
CCGCCGCCGACGGCGATCCCCCCGCCGTCGCCGAGGAGGCAGTCCTTGCGTCTGCAGGAGAAGGCGGCCAAGAAG
GTGGGCTACAATAGCCCGCTGACGCAAGAGATTGTCACGAATCAGTATACGAAATCCCACATGGAGCTTCTCGAC
GAGGACACGTCTCCGAGTTCTCCTCAGCGGACAACGACGGTGGAGCCAGACGCTCATGCTCAGGACCAGTCACGA
CCAGCCCTGCCCTCCACCGCCGAGAAGGATCAGGCCGGAACAACGGGCGAATCAACAGCATGGTATCGCAAACGA
AGACAAACCGAGAAGAAGCGCCGATGGGTCTGGACCATCGGCCAAGACGAAGAAGACGACGAGAGCCCTATACCA
GTGCCGCAAGAATCCACCGCCGACACGACAACAACTCCAACACCAACAGCCAGCCTCGAAGGCAGCAGCGCCGAC
ACGGAGAGCGCATCCTCATCAGCCCTAGCCTCCGCCGTCGACGCCAGCGCATCCGACACGTGCAGCCTCGACTGG
ACCGACGACGAGCAGCACGCAGAGGGCGAGTCCGGCCCGGAAGCAAAGACGCCCACGTCAACGCGCCGTCTCGAT
GGCGCCGTCGTCCAGCGGGATACGCCCGTGCCGGAGCTGCTACCCAGTCGGGGTATGTCGGTGTAG
Transcript >Ophun1|6034
ATGCAACGAAGCTTCGACGACGACCTCAAGCTGGACTCATCAGAGAATCCCTTCATGGCTCAGCAGCAGTGTTCC
GGCGGCATGAAGAGGCCCAGGCTGTCTCTTCAGATCACGACTACTTCGCGGACGGGTCGGGCCGTGAGCGTCGAG
ACGTCTTCTTCTGAGCCGCTGACGGCCATCAACACGCTGCGATGCTTCAGTCTCGATACGCCAACCGAGGACAAG
ACGGTCGTTTCCCGGGCCATCACGCCCTACGTCGCCTCGTACCCGGAGACCCCCCTGACAGCACAGCCCACGTCG
CCCTCACAGCTGGAAGTGCACTACTATTCCGACACCATGACGGCCACGCCTCCGCTCTCGGCCGACGCGGGGCCG
TCCTCCTTTACCTTTGGCTCCGACGACGACGACGACGACGACGACGACGACGACGATAGCTCCCGGTCACTCCCG
GTCGTGGCCGGTGACGTCCGTCCTCCGTATTCACACCCGCGGAGCTTGCACAGCATTCTTCGCAACTCTCCGCTT
CCGCCGCCGACGGCGATCCCCCCGCCGTCGCCGAGGAGGCAGTCCTTGCGTCTGCAGGAGAAGGCGGCCAAGAAG
GTGGGCTACAATAGCCCGCTGACGCAAGAGATTGTCACGAATCAGTATACGAAATCCCACATGGAGCTTCTCGAC
GAGGACACGTCTCCGAGTTCTCCTCAGCGGACAACGACGGTGGAGCCAGACGCTCATGCTCAGGACCAGTCACGA
CCAGCCCTGCCCTCCACCGCCGAGAAGGATCAGGCCGGAACAACGGGCGAATCAACAGCATGGTATCGCAAACGA
AGACAAACCGAGAAGAAGCGCCGATGGGTCTGGACCATCGGCCAAGACGAAGAAGACGACGAGAGCCCTATACCA
GTGCCGCAAGAATCCACCGCCGACACGACAACAACTCCAACACCAACAGCCAGCCTCGAAGGCAGCAGCGCCGAC
ACGGAGAGCGCATCCTCATCAGCCCTAGCCTCCGCCGTCGACGCCAGCGCATCCGACACGTGCAGCCTCGACTGG
ACCGACGACGAGCAGCACGCAGAGGGCGAGTCCGGCCCGGAAGCAAAGACGCCCACGTCAACGCGCCGTCTCGAT
GGCGCCGTCGTCCAGCGGGATACGCCCGTGCCGGAGCTGCTACCCAGTCGGGGTATGTCGGTGTAG
Gene >Ophun1|6034
ATGCAACGAAGCTTCGACGACGACCTCAAGCTGGACTCATCAGAGAATCCCTGTCCGTTCCATCGACCCCGCTTC
CAAACGAGCCATCGTTGCATGATAGACGCCGAGGCCACGACAAGGCAGCGGCTGATTCGCCGGCTCCGATTGCCA
CAAACCCCCATCTCGGCGCTTAAAAAGCCCTTGGCTCACGAGTCATGATGGGCCGGATATTGTCGACCTGGTTGC
AGCGGGCTAGCAGGGACGCGCTGCAGAGCTAGCGGCGCTTGTCTCGGCTCAGCCCACGCTTCTGCGGCCGCCACG
ATAGGCGCCGTCGACGTTGTATATACCTGATGGGCTTTCCCGCCTTTGCTGTTTGCCTGCTGGTGGCAAGGCAGT
CATGGCTCAGCAGCAGTGTTCCGGCGGCATGAAGAGGCCCAGGCTGTCTCTTCAGATCACGACTACTTCGCGGAC
GGGTCGGGCCGTGAGCGTCGAGACGTCTTCTTCTGAGCCGCTGACGGCCATCAACACGCTGCGATGCTTCAGTCT
CGATACGCCAACCGAGGACAAGACGGTCGTTTCCCGGGCCATCACGCCCTACGTCGCCTCGTACCCGGAGACCCC
CCTGACAGCACAGCCCACGTCGCCCTCACAGCTGGAAGTGCACTACTATTCCGACACCATGACGGCCACGCCTCC
GCTCTCGGCCGACGCGGGGCCGTCCTCCTTTACCTTTGGCTCCGACGACGACGACGACGACGACGACGACGACGA
CGATAGCTCCCGGTCACTCCCGGTCGTGGCCGGTGACGTCCGTCCTCCGTATTCACACCCGCGGAGCTTGCACAG
CATTCTTCGCAACTCTCCGCTTCCGCCGCCGACGGCGATCCCCCCGCCGTCGCCGAGGAGGCAGTCCTTGCGTCT
GCAGGAGAAGGCGGCCAAGAAGGTGGGCTACAATAGCCCGCTGACGCAAGAGATTGTCACGAATCAGTATACGAA
ATCCCACATGGAGCTTCTCGACGAGGACACGTCTCCGAGTTCTCCTCAGCGGACAACGACGGTGGAGCCAGACGC
TCATGCTCAGGACCAGTCACGACCAGCCCTGCCCTCCACCGCCGAGAAGGATCAGGCCGGAACAACGGGCGAATC
AACAGCATGGTATCGCAAACGAAGACAAACCGAGAAGAAGCGCCGATGGGTCTGGACCATCGGCCAAGACGAAGA
AGACGACGAGAGCCCTATACCAGTGCCGCAAGAATCCACCGCCGACACGACAACAACTCCAACACCAACAGCCAG
CCTCGAAGGCAGCAGCGCCGACACGGAGAGCGCATCCTCATCAGCCCTAGCCTCCGCCGTCGACGCCAGCGCATC
CGACACGTGCAGCCTCGACTGGACCGACGACGAGCAGCACGCAGAGGGCGAGTCCGGCCCGGAAGCAAAGACGCC
CACGTCAACGCGCCGTCTCGATGGCGCCGTCGTCCAGCGGGATACGCCCGTGCCGGAGCTGCTACCCAGTCGGGG
TATGTCGGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail