Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6027
Gene name
LocationContig_63:3762..5853
Strand+
Gene length (bp)2091
Transcript length (bp)2091
Coding sequence length (bp)2091
Protein length (aa) 697

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03343 SART-1 SART-1 family 4.3E-143 74 660
PF19252 HIND HIND motif 3.0E-09 5 24

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94538|SNU66_SCHPO U4/U6.U5 tri-snRNP-associated protein snu66 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snu66 PE=1 SV=1 2 669 1.0E-47
sp|O43290|SNUT1_HUMAN U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens GN=SART1 PE=1 SV=1 5 253 1.0E-19
sp|Q5XIW8|SNUT1_RAT U4/U6.U5 tri-snRNP-associated protein 1 OS=Rattus norvegicus GN=Sart1 PE=1 SV=1 5 253 3.0E-18
sp|Q9Z315|SNUT1_MOUSE U4/U6.U5 tri-snRNP-associated protein 1 OS=Mus musculus GN=Sart1 PE=1 SV=1 5 253 4.0E-18
sp|O43290|SNUT1_HUMAN U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens GN=SART1 PE=1 SV=1 611 675 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94538|SNU66_SCHPO U4/U6.U5 tri-snRNP-associated protein snu66 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snu66 PE=1 SV=1 2 669 1.0E-47
sp|O43290|SNUT1_HUMAN U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens GN=SART1 PE=1 SV=1 5 253 1.0E-19
sp|Q5XIW8|SNUT1_RAT U4/U6.U5 tri-snRNP-associated protein 1 OS=Rattus norvegicus GN=Sart1 PE=1 SV=1 5 253 3.0E-18
sp|Q9Z315|SNUT1_MOUSE U4/U6.U5 tri-snRNP-associated protein 1 OS=Mus musculus GN=Sart1 PE=1 SV=1 5 253 4.0E-18
sp|O43290|SNUT1_HUMAN U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens GN=SART1 PE=1 SV=1 611 675 3.0E-11
sp|Q5XIW8|SNUT1_RAT U4/U6.U5 tri-snRNP-associated protein 1 OS=Rattus norvegicus GN=Sart1 PE=1 SV=1 611 675 3.0E-11
sp|Q9Z315|SNUT1_MOUSE U4/U6.U5 tri-snRNP-associated protein 1 OS=Mus musculus GN=Sart1 PE=1 SV=1 611 675 3.0E-11
sp|Q9LFE0|DOT2_ARATH SART-1 family protein DOT2 OS=Arabidopsis thaliana GN=DOT2 PE=1 SV=1 615 660 4.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0000398 mRNA splicing, via spliceosome Yes
GO:0046540 U4/U6 x U5 tri-snRNP complex Yes
GO:0090304 nucleic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0006396 RNA processing No
GO:0008152 metabolic process No
GO:0032991 protein-containing complex No
GO:0006397 mRNA processing No
GO:0030532 small nuclear ribonucleoprotein complex No
GO:0140513 nuclear protein-containing complex No
GO:0097525 spliceosomal snRNP complex No
GO:0120114 Sm-like protein family complex No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0000377 RNA splicing, via transesterification reactions with bulged adenosine as nucleophile No
GO:0008380 RNA splicing No
GO:0005575 cellular_component No
GO:1990904 ribonucleoprotein complex No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016071 mRNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0097526 spliceosomal tri-snRNP complex No
GO:0000375 RNA splicing, via transesterification reactions No
GO:0016070 RNA metabolic process No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
SART1

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6027
MDAATIEETNRIRLSLGMKPLPVPGATSSHQPTEQTTASNGDGEAASTLESRQAQAYDNYKSHMEADVNKRRREA
KAAAVRKARDDAQRFALLDGKGLGEADKDGDVDTKTWLKNQKKRQKRIEKAKKAQKLMDDLLEAEELAASTYTSK
DLAGLKVAHDSSVFIEGDEQILTLKDATIDENEEAGDELENINLRETEKLNDTLKLKKQRPGYNPLDDENEDGKR
GILSQYDDEILGKQSKQFTLDANGTLDGGTDILTQPPPDTKKKWMMGLDDIVGKFKGLLPDLWNRADAGKGEGPT
SSDYLAPPQVKFRKRAKNKHARKIEKKEEDYLLPADWKLDTSPIVVGGETFTIKKRKVDADALLDDDDELQKSLA
AQRKVALQKRQKVQKTDIGELCRQVRARANEPEPLDESMQGGLVIGQVSEFIASLRKHDEEDKPRSKRRRNTTTS
GIHTEATPTAASLSEDKPMVDVDEQTNDTIPIQATQDNNNNNDNNNKTNDGDDGDILDNEKTVGGSISATLALLR
ERGLIEESRGDATHRSQRSRQDFLLRKRQLEDELDEKARQQRERDRASGKLDRMSRADREDYARQQNAWRDQQHS
RRMADLISSTYRPTVELKYTDEHGRTLDQKEAFKHLSHQFHGKGSGKGKTEKKLKQVEEEKRREAQSLFDASQGS
GMSAATSQQIKKRKEAGVRLG*
Coding >Ophun1|6027
ATGGACGCCGCGACCATCGAGGAGACGAACCGCATTCGGCTGTCGCTGGGCATGAAGCCCTTGCCGGTCCCCGGA
GCGACTTCCTCTCATCAGCCAACAGAGCAGACCACAGCCTCCAACGGCGATGGCGAAGCTGCGAGCACCCTCGAA
AGCCGTCAGGCACAGGCATACGACAACTACAAGAGCCACATGGAAGCCGACGTCAACAAGCGCCGACGCGAGGCA
AAGGCTGCAGCCGTCCGCAAGGCCCGAGACGACGCTCAACGCTTCGCCCTTCTCGATGGCAAAGGGCTCGGCGAA
GCGGACAAGGATGGCGACGTCGACACCAAAACGTGGCTGAAGAACCAGAAGAAACGCCAGAAACGGATCGAAAAA
GCCAAAAAGGCCCAGAAGCTGATGGACGACCTGCTTGAGGCAGAAGAACTGGCCGCCTCTACGTACACGTCAAAG
GACCTTGCCGGCCTCAAGGTCGCCCACGACTCGTCGGTCTTTATCGAGGGAGACGAGCAGATTCTCACGCTCAAG
GATGCCACCATCGATGAAAACGAAGAAGCTGGCGATGAGCTGGAAAACATCAACCTTCGCGAGACGGAGAAGCTC
AACGACACGCTGAAGCTCAAGAAGCAACGACCCGGATATAACCCCCTCGATGACGAGAATGAAGACGGGAAGCGT
GGAATACTCTCGCAATACGACGACGAGATTTTAGGAAAACAGTCCAAGCAGTTCACCCTCGATGCAAATGGCACC
CTGGACGGCGGCACTGACATACTAACCCAACCGCCTCCCGACACCAAGAAGAAGTGGATGATGGGTCTTGACGAC
ATCGTCGGTAAGTTCAAAGGACTCCTTCCCGATCTATGGAATCGGGCTGATGCCGGGAAAGGCGAGGGCCCAACC
TCGTCCGATTACCTGGCCCCTCCCCAGGTCAAATTCAGGAAGCGGGCGAAGAACAAGCATGCGCGGAAAATCGAA
AAGAAAGAAGAAGATTACCTTCTTCCCGCGGACTGGAAACTAGATACCAGCCCAATTGTAGTGGGCGGAGAAACG
TTTACGATCAAGAAGCGCAAAGTCGATGCCGACGCCCTCTTGGACGACGACGACGAGCTGCAGAAATCACTGGCC
GCCCAGCGCAAGGTTGCTCTCCAGAAGCGTCAGAAGGTACAGAAGACAGACATCGGTGAACTCTGCAGGCAAGTC
AGGGCGCGAGCAAACGAGCCAGAGCCGCTCGACGAGAGCATGCAAGGCGGCCTCGTCATCGGCCAAGTATCCGAG
TTCATCGCCAGCCTGCGAAAACACGACGAAGAAGACAAGCCGAGATCGAAGAGACGACGCAACACGACAACCAGC
GGCATTCACACCGAGGCTACCCCGACAGCAGCATCACTCAGCGAAGATAAACCCATGGTCGACGTCGACGAGCAA
ACCAACGACACCATCCCCATCCAAGCAACACAAGACAACAACAACAACAACGACAACAACAACAAGACCAACGAC
GGCGACGACGGCGACATCCTCGACAACGAAAAGACGGTAGGCGGAAGCATAAGCGCCACCCTCGCCCTCCTCCGC
GAAAGAGGCCTCATCGAAGAATCCCGCGGCGACGCAACCCACCGAAGCCAACGCTCCCGCCAAGATTTCCTCCTC
CGCAAGCGCCAACTCGAAGACGAACTCGACGAGAAAGCCCGCCAGCAGCGCGAACGAGACCGCGCCTCGGGGAAA
CTAGACCGCATGTCCCGCGCCGACCGCGAAGATTACGCCCGTCAGCAGAACGCCTGGCGCGATCAGCAGCACTCG
CGTCGCATGGCAGACCTCATCTCCTCCACCTACCGCCCCACCGTCGAGCTCAAGTACACGGATGAGCATGGCAGG
ACCCTCGATCAGAAGGAGGCCTTTAAGCATCTCAGTCATCAGTTCCATGGCAAGGGGAGTGGTAAGGGCAAGACG
GAGAAGAAGCTTAAGCAGGTTGAGGAGGAGAAGAGGCGGGAGGCTCAGAGCCTCTTTGATGCTAGTCAGGGGAGT
GGCATGAGCGCTGCTACCAGCCAGCAGATCAAGAAGCGCAAGGAAGCGGGCGTGAGACTGGGATGA
Transcript >Ophun1|6027
ATGGACGCCGCGACCATCGAGGAGACGAACCGCATTCGGCTGTCGCTGGGCATGAAGCCCTTGCCGGTCCCCGGA
GCGACTTCCTCTCATCAGCCAACAGAGCAGACCACAGCCTCCAACGGCGATGGCGAAGCTGCGAGCACCCTCGAA
AGCCGTCAGGCACAGGCATACGACAACTACAAGAGCCACATGGAAGCCGACGTCAACAAGCGCCGACGCGAGGCA
AAGGCTGCAGCCGTCCGCAAGGCCCGAGACGACGCTCAACGCTTCGCCCTTCTCGATGGCAAAGGGCTCGGCGAA
GCGGACAAGGATGGCGACGTCGACACCAAAACGTGGCTGAAGAACCAGAAGAAACGCCAGAAACGGATCGAAAAA
GCCAAAAAGGCCCAGAAGCTGATGGACGACCTGCTTGAGGCAGAAGAACTGGCCGCCTCTACGTACACGTCAAAG
GACCTTGCCGGCCTCAAGGTCGCCCACGACTCGTCGGTCTTTATCGAGGGAGACGAGCAGATTCTCACGCTCAAG
GATGCCACCATCGATGAAAACGAAGAAGCTGGCGATGAGCTGGAAAACATCAACCTTCGCGAGACGGAGAAGCTC
AACGACACGCTGAAGCTCAAGAAGCAACGACCCGGATATAACCCCCTCGATGACGAGAATGAAGACGGGAAGCGT
GGAATACTCTCGCAATACGACGACGAGATTTTAGGAAAACAGTCCAAGCAGTTCACCCTCGATGCAAATGGCACC
CTGGACGGCGGCACTGACATACTAACCCAACCGCCTCCCGACACCAAGAAGAAGTGGATGATGGGTCTTGACGAC
ATCGTCGGTAAGTTCAAAGGACTCCTTCCCGATCTATGGAATCGGGCTGATGCCGGGAAAGGCGAGGGCCCAACC
TCGTCCGATTACCTGGCCCCTCCCCAGGTCAAATTCAGGAAGCGGGCGAAGAACAAGCATGCGCGGAAAATCGAA
AAGAAAGAAGAAGATTACCTTCTTCCCGCGGACTGGAAACTAGATACCAGCCCAATTGTAGTGGGCGGAGAAACG
TTTACGATCAAGAAGCGCAAAGTCGATGCCGACGCCCTCTTGGACGACGACGACGAGCTGCAGAAATCACTGGCC
GCCCAGCGCAAGGTTGCTCTCCAGAAGCGTCAGAAGGTACAGAAGACAGACATCGGTGAACTCTGCAGGCAAGTC
AGGGCGCGAGCAAACGAGCCAGAGCCGCTCGACGAGAGCATGCAAGGCGGCCTCGTCATCGGCCAAGTATCCGAG
TTCATCGCCAGCCTGCGAAAACACGACGAAGAAGACAAGCCGAGATCGAAGAGACGACGCAACACGACAACCAGC
GGCATTCACACCGAGGCTACCCCGACAGCAGCATCACTCAGCGAAGATAAACCCATGGTCGACGTCGACGAGCAA
ACCAACGACACCATCCCCATCCAAGCAACACAAGACAACAACAACAACAACGACAACAACAACAAGACCAACGAC
GGCGACGACGGCGACATCCTCGACAACGAAAAGACGGTAGGCGGAAGCATAAGCGCCACCCTCGCCCTCCTCCGC
GAAAGAGGCCTCATCGAAGAATCCCGCGGCGACGCAACCCACCGAAGCCAACGCTCCCGCCAAGATTTCCTCCTC
CGCAAGCGCCAACTCGAAGACGAACTCGACGAGAAAGCCCGCCAGCAGCGCGAACGAGACCGCGCCTCGGGGAAA
CTAGACCGCATGTCCCGCGCCGACCGCGAAGATTACGCCCGTCAGCAGAACGCCTGGCGCGATCAGCAGCACTCG
CGTCGCATGGCAGACCTCATCTCCTCCACCTACCGCCCCACCGTCGAGCTCAAGTACACGGATGAGCATGGCAGG
ACCCTCGATCAGAAGGAGGCCTTTAAGCATCTCAGTCATCAGTTCCATGGCAAGGGGAGTGGTAAGGGCAAGACG
GAGAAGAAGCTTAAGCAGGTTGAGGAGGAGAAGAGGCGGGAGGCTCAGAGCCTCTTTGATGCTAGTCAGGGGAGT
GGCATGAGCGCTGCTACCAGCCAGCAGATCAAGAAGCGCAAGGAAGCGGGCGTGAGACTGGGATGA
Gene >Ophun1|6027
ATGGACGCCGCGACCATCGAGGAGACGAACCGCATTCGGCTGTCGCTGGGCATGAAGCCCTTGCCGGTCCCCGGA
GCGACTTCCTCTCATCAGCCAACAGAGCAGACCACAGCCTCCAACGGCGATGGCGAAGCTGCGAGCACCCTCGAA
AGCCGTCAGGCACAGGCATACGACAACTACAAGAGCCACATGGAAGCCGACGTCAACAAGCGCCGACGCGAGGCA
AAGGCTGCAGCCGTCCGCAAGGCCCGAGACGACGCTCAACGCTTCGCCCTTCTCGATGGCAAAGGGCTCGGCGAA
GCGGACAAGGATGGCGACGTCGACACCAAAACGTGGCTGAAGAACCAGAAGAAACGCCAGAAACGGATCGAAAAA
GCCAAAAAGGCCCAGAAGCTGATGGACGACCTGCTTGAGGCAGAAGAACTGGCCGCCTCTACGTACACGTCAAAG
GACCTTGCCGGCCTCAAGGTCGCCCACGACTCGTCGGTCTTTATCGAGGGAGACGAGCAGATTCTCACGCTCAAG
GATGCCACCATCGATGAAAACGAAGAAGCTGGCGATGAGCTGGAAAACATCAACCTTCGCGAGACGGAGAAGCTC
AACGACACGCTGAAGCTCAAGAAGCAACGACCCGGATATAACCCCCTCGATGACGAGAATGAAGACGGGAAGCGT
GGAATACTCTCGCAATACGACGACGAGATTTTAGGAAAACAGTCCAAGCAGTTCACCCTCGATGCAAATGGCACC
CTGGACGGCGGCACTGACATACTAACCCAACCGCCTCCCGACACCAAGAAGAAGTGGATGATGGGTCTTGACGAC
ATCGTCGGTAAGTTCAAAGGACTCCTTCCCGATCTATGGAATCGGGCTGATGCCGGGAAAGGCGAGGGCCCAACC
TCGTCCGATTACCTGGCCCCTCCCCAGGTCAAATTCAGGAAGCGGGCGAAGAACAAGCATGCGCGGAAAATCGAA
AAGAAAGAAGAAGATTACCTTCTTCCCGCGGACTGGAAACTAGATACCAGCCCAATTGTAGTGGGCGGAGAAACG
TTTACGATCAAGAAGCGCAAAGTCGATGCCGACGCCCTCTTGGACGACGACGACGAGCTGCAGAAATCACTGGCC
GCCCAGCGCAAGGTTGCTCTCCAGAAGCGTCAGAAGGTACAGAAGACAGACATCGGTGAACTCTGCAGGCAAGTC
AGGGCGCGAGCAAACGAGCCAGAGCCGCTCGACGAGAGCATGCAAGGCGGCCTCGTCATCGGCCAAGTATCCGAG
TTCATCGCCAGCCTGCGAAAACACGACGAAGAAGACAAGCCGAGATCGAAGAGACGACGCAACACGACAACCAGC
GGCATTCACACCGAGGCTACCCCGACAGCAGCATCACTCAGCGAAGATAAACCCATGGTCGACGTCGACGAGCAA
ACCAACGACACCATCCCCATCCAAGCAACACAAGACAACAACAACAACAACGACAACAACAACAAGACCAACGAC
GGCGACGACGGCGACATCCTCGACAACGAAAAGACGGTAGGCGGAAGCATAAGCGCCACCCTCGCCCTCCTCCGC
GAAAGAGGCCTCATCGAAGAATCCCGCGGCGACGCAACCCACCGAAGCCAACGCTCCCGCCAAGATTTCCTCCTC
CGCAAGCGCCAACTCGAAGACGAACTCGACGAGAAAGCCCGCCAGCAGCGCGAACGAGACCGCGCCTCGGGGAAA
CTAGACCGCATGTCCCGCGCCGACCGCGAAGATTACGCCCGTCAGCAGAACGCCTGGCGCGATCAGCAGCACTCG
CGTCGCATGGCAGACCTCATCTCCTCCACCTACCGCCCCACCGTCGAGCTCAAGTACACGGATGAGCATGGCAGG
ACCCTCGATCAGAAGGAGGCCTTTAAGCATCTCAGTCATCAGTTCCATGGCAAGGGGAGTGGTAAGGGCAAGACG
GAGAAGAAGCTTAAGCAGGTTGAGGAGGAGAAGAGGCGGGAGGCTCAGAGCCTCTTTGATGCTAGTCAGGGGAGT
GGCATGAGCGCTGCTACCAGCCAGCAGATCAAGAAGCGCAAGGAAGCGGGCGTGAGACTGGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail